CD40 Monoclonal antibody

CD40 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 66965-1-Ig
Clone No.2A8G5

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, IF-P, ELISA

2A8G5, B cell surface antigen CD40, B-cell surface antigen CD40, Bp50, CD40L receptor

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inRaji cells, Daudi cells
Positive IHC detected inhuman tonsillitis tissue, human lymphoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman tonsillitis tissue
Positive IF/ICC detected inRamos cells, Raji cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:2500-1:10000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66965-1-Ig targets CD40 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28040

Product name: Recombinant human CD40 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 24-193 aa of BC012419

Sequence: TACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR

Predict reactive species
Full Name CD40 molecule, TNF receptor superfamily member 5
Calculated Molecular Weight 277 aa, 31 kDa
Observed Molecular Weight 43 kDa
GenBank Accession NumberBC012419
Gene Symbol CD40
Gene ID (NCBI) 958
ENSEMBL Gene IDENSG00000101017
RRIDAB_2882288
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP25942
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cluster of differentiation 40 (CD40) is a costimulatory protein located on antigen presenting cells and is required for their activation. CD40 is a member of the tumor necrosis factor (TNF) receptor (TNFR) family.

What is the molecular weight of CD40?

The molecular weight of CD40 is 43 kDa.

What is the cellular localization of CD40?

CD40 can be secreted by cells or found in the cell membrane.

What is the tissue specificity of CD40?

CD40 is expressed in B cells and primary carcinoma cells but is also found in dendritic cells and macrophages (PMID: 10209159).

What is the function of CD40?

CD40 acts as a receptor for TNFSF5/CD40LG, which is expressed on activated T cells. This interaction is essential for B cell proliferation, expression of activation markers, immunoglobulin production, and isotype switching (PMID: 8809473). This interaction is also crucial for the formation of memory B cells and germinal centers, and signaling through CD40 prevents apoptosis of germinal center B cells.

What is the role of CD40 in disease?

Defects in CD40 lead to hyper-IgM immunodeficiency syndrome type 3 (HIGM3) (PMID: 11675497). This is an autosomal recessive disorder that includes the inability of B cells to undergo isotype switching, a key step in the final differentiation of the humoral immune response, and an inability to mount an antibody-specific immune response.


Protocols

Product Specific Protocols
IF protocol for CD40 antibody 66965-1-IgDownload protocol
IHC protocol for CD40 antibody 66965-1-IgDownload protocol
WB protocol for CD40 antibody 66965-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

J Clin Transl Hepatol

A Prognostic Nomogram for Hepatocellular Carcinoma Based on Wound Healing and Immune Checkpoint Genes

Authors - Beiyuan Hu
WB

Int J Mol Sci

Exosomal CD40, CD25, and Serum CA19-9 as Combinatory Novel Liquid Biopsy Biomarker for the Diagnosis and Prognosis of Patients with Pancreatic Ductal Adenocarcinoma

Authors - Paul David
Human

Ann Transl Med

Comprehensive analysis of immune-related genes associated with the microenvironment of patients with unexplained infertility

Authors - Caiyun Wang
Loading...
||
New chat

Able

正在加载,请稍候...