CoraLite®594-conjugated CD40 Monoclonal antibody

CD40 Monoclonal Antibody for IF-P

Cat No. CL594-66965
Clone No.2A8G5

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

IF-P

B cell surface antigen CD40, Bp50, CD40, CD40L receptor, CDW40, p50, TNFRSF5

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman tonsillitis tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66965 targets CD40 in IF-P applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28040

Product name: Recombinant human CD40 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 24-193 aa of BC012419

Sequence: TACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR

Predict reactive species
Full Name CD40 molecule, TNF receptor superfamily member 5
Calculated Molecular Weight 277 aa, 31 kDa
GenBank Accession NumberBC012419
Gene Symbol CD40
Gene ID (NCBI) 958
ENSEMBL Gene IDENSG00000101017
RRIDAB_2920065
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP25942
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Cluster of differentiation 40 (CD40) is a costimulatory protein located on antigen presenting cells and is required for their activation. CD40 is a member of the tumor necrosis factor (TNF) receptor (TNFR) family.

What is the molecular weight of CD40?

The molecular weight of CD40 is 43 kDa.

What is the cellular localization of CD40?

CD40 can be secreted by cells or found in the cell membrane.

What is the tissue specificity of CD40?

CD40 is expressed in B cells and primary carcinoma cells but is also found in dendritic cells and macrophages (PMID: 10209159).

What is the function of CD40?

CD40 acts as a receptor for TNFSF5/CD40LG, which is expressed on activated T cells. This interaction is essential for B cell proliferation, expression of activation markers, immunoglobulin production, and isotype switching (PMID: 8809473). This interaction is also crucial for the formation of memory B cells and germinal centers, and signaling through CD40 prevents apoptosis of germinal center B cells.

What is the role of CD40 in disease?

Defects in CD40 lead to hyper-IgM immunodeficiency syndrome type 3 (HIGM3) (PMID: 11675497). This is an autosomal recessive disorder that includes the inability of B cells to undergo isotype switching, a key step in the final differentiation of the humoral immune response, and an inability to mount an antibody-specific immune response.


Protocols

Product Specific Protocols
IF protocol for CL594 CD40 antibody CL594-66965Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...