CD47 Polyclonal antibody

• 

  WB analysis using 31886-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31886-1-AP (CD47 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

CD47 Polyclonal Antibody for WB, ELISA

Cat No. 31886-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, ELISA

Synonyms

IAP, Integrin-associated protein, Leukocyte surface antigen CD47

---

Tested Applications

• Positive WB detected in: PNGF treated NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31886-1-AP targets CD47 in WB, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg1394

  Product name: Recombinant Mouse CD47 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 19-140 aa of NP_001355344.1

  Sequence: QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEK

• Full Name: CD47 antigen (Rh-related antigen, integrin-associated signal transducer)
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: ~30 kDa, 40-50 kDa
• GenBank Accession Number: NP_001355344.1
• Gene Symbol: Cd47
• Gene ID (NCBI): 16423
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q61735-1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD47, also known as integrin-associated protein (IAP), is a member of the immunoglobulin superfamily containing a five-pass transmembrane attachment. CD47 is heavily glycosylated and widely expressed by hematopoietic and nonhematopoietic cells. CD47 interacts with several membrane integrins and also acts as a receptor for thrombospondin (THBS1). It is involved in a range of cellular processes, including apoptosis, proliferation, adhesion, and migration. CD47 also functions as a ligand for signal regulatory protein-α (SIRPα). Upon binding CD47, SIRPα initiates a signaling cascade that results in the inhibition of phagocytosis.