CD47 Monoclonal antibody

• 

  IF Staining of A431 using 60551-1-Ig

  Immunofluorescent analysis of un-fixed A431 cells using CD47 antibody (60551-1-Ig, Clone: 1A4C4 ) at dilution of 1:1000 and Multi-rAb CoraLite® Plus 594-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (Cat.NO. RGAM004 ).

• 

  IF Staining of A431 using 60551-1-Ig

  Immunofluorescent analysis of un-fixed A431 cells using CD47 antibody (60551-1-Ig, Clone: 1A4C4 ) at dilution of 1:500 and Multi-rAb CoraLite® Plus 594-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (Cat.NO. RGAM004 ).

• 

  IF Staining of Jurkat using 60551-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using CD47 antibody (60551-1-Ig, Clone: 1A4C4 ) at dilution of 1:250 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1).

• 

  FC experiment of human PBMCs using 60551-1-Ig

  1x10^6 human PBMCs were surface stained with 0.2 μg CD47 Monoclonal Antibody (60551-1-Ig, Clone: 1A4C4, right) and Multi-rAb CoraLite® Plus 647-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM005). Mouse IgG1 isotype control (66360-1-Ig, Clone: 1F8D3, left) was parallel stained as control. Cells were not fixed.

CD47 Monoclonal Antibody for IF/ICC, FC, ELISA

Cat No. 60551-1-Ig

Clone No.1A4C4

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC, FC, ELISA

Synonyms

1A4C4, CD47 molecule, IAP, Integrin associated protein, Integrin-associated protein

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells, A431 cells, Jurkat cells
• Positive FC detected in: human PBMCs

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000
• Flow Cytometry (FC): FC : 0.20 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

60551-1-Ig targets CD47 in IF/ICC, FC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg31499

  Product name: Recombinant Human CD47 protein (Myc Tag, His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: Myc & 6*His

  Domain: 19-139 aa of BC010016

  Sequence: QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVCVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

• Full Name: CD47 molecule
• Calculated Molecular Weight: 323 aa, 35 kDa
• GenBank Accession Number: BC010016
• Gene Symbol: CD47
• Gene ID (NCBI): 961
• RRID: AB_3670268
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q08722
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD47, also known as integrin-associated protein (IAP), is a member of the immunoglobulin superfamily containing a five-pass transmembrane attachment. CD47 is heavily glycosylated and widely expressed by hematopoietic and nonhematopoietic cells. CD47 interacts with several membrane integrins and also acts a receptor for thrombospondin (THBS1). It is involved in a range of cellular processes, including apoptosis, proliferation, adhesion, and migration. CD47 also functions as a ligand for signal regulatory protein-α (SIRPα). Upon binding CD47, SIRPα initiates a signaling cascade that results in the inhibition of phagocytosis.