CD47 Monoclonal antibody, PBS Only

• 

  IF Staining of A431 using 60551-1-Ig (same clone as 60551-1-PBS)

  Immunofluorescent analysis of un-fixed A431 cells using CD47 antibody (60551-1-Ig, Clone: 1A4C4 ) at dilution of 1:1000 and Multi-rAb CoraLite® Plus 594-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (Cat.NO. RGAM004 ). This data was developed using the same antibody clone with 60551-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 60551-1-Ig (same clone as 60551-1-PBS)

  Immunofluorescent analysis of un-fixed A431 cells using CD47 antibody (60551-1-Ig, Clone: 1A4C4 ) at dilution of 1:500 and Multi-rAb CoraLite® Plus 594-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (Cat.NO. RGAM004 ). This data was developed using the same antibody clone with 60551-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Jurkat using 60551-1-Ig (same clone as 60551-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using CD47 antibody (60551-1-Ig, Clone: 1A4C4 ) at dilution of 1:250 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 60551-1-PBS in a different storage buffer formulation.

• 

  FC experiment of human PBMCs using 60551-1-Ig (same clone as 60551-1-PBS)

  1x10^6 human PBMCs were surface stained with 0.2 μg CD47 Monoclonal Antibody (60551-1-Ig, Clone: 1A4C4, right) and Multi-rAb CoraLite® Plus 647-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM005). Mouse IgG1 isotype control (66360-1-Ig, Clone: 1F8D3, left) was parallel stained as control. Cells were not fixed. This data was developed using the same antibody clone with 60551-1-PBS in a different storage buffer formulation.

CD47 Monoclonal Antibody for IF/ICC, FC, Indirect ELISA

Cat No. 60551-1-PBS

Clone No.1A4C4

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC, FC, Indirect ELISA

Synonyms

1A4C4, CD47 molecule, IAP, Integrin associated protein, Integrin-associated protein

---

Product Information

60551-1-PBS targets CD47 in IF/ICC, FC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg31499

  Product name: Recombinant Human CD47 protein (Myc Tag, His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: Myc & 6*His

  Domain: 19-139 aa of BC010016

  Sequence: QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVCVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

• Full Name: CD47 molecule
• Calculated Molecular Weight: 323 aa, 35 kDa
• GenBank Accession Number: BC010016
• Gene Symbol: CD47
• Gene ID (NCBI): 961
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q08722
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD47, also known as integrin-associated protein (IAP), is a member of the immunoglobulin superfamily containing a five-pass transmembrane attachment. CD47 is heavily glycosylated and widely expressed by hematopoietic and nonhematopoietic cells. CD47 interacts with several membrane integrins and also acts a receptor for thrombospondin (THBS1). It is involved in a range of cellular processes, including apoptosis, proliferation, adhesion, and migration. CD47 also functions as a ligand for signal regulatory protein-α (SIRPα). Upon binding CD47, SIRPα initiates a signaling cascade that results in the inhibition of phagocytosis.