Mouse CD53 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of RAW 264.7 using 85838-3-RR (same clone as 85838-3-PBS)

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 85838-3-RR (CD53 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85838-3-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 85838-3-RR (same clone as 85838-3-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 85838-3-RR (Cd53 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85838-3-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 85838-3-RR (same clone as 85838-3-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 85838-3-RR (Cd53 antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85838-3-PBS in a different storage buffer formulation.

• 

  IF Staining of A20 using 85838-3-RR (same clone as 85838-3-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A20 cells using Cd53 antibody (85838-3-RR, Clone: 250105D10 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 85838-3-PBS in a different storage buffer formulation.

CD53 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 85838-3-PBS

Clone No.250105D10

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Cell surface glycoprotein CD53, Leukocyte surface antigen CD53

---

Product Information

85838-3-PBS targets CD53 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2684

  Product name: Recombinant Mouse CD53 protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 107-181 aa of NM_007651.3

  Sequence: EQKLNTLVAEGLNDSIQHYHSDNSTMKAWDFIQTQLQCCGVNGSSDWTSGPPSSCPSGADVQGCYNKAKSWFHSN

• Full Name: CD53 antigen
• Calculated Molecular Weight: 24 kDa
• Observed Molecular Weight: 35-40 kDa
• GenBank Accession Number: NM_007651.3
• Gene Symbol: Cd53
• Gene ID (NCBI): 12508
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q61451
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD53 is also named as MOX44 and Tetraspanin-25 (Tspan-25). Tetraspanin CD53 is a member of the tetraspanin superfamily expressed exclusively within the immune compartment (PMID: 32440787). T cells depend on the phosphatase CD45 to initiate T cell receptor signaling. CD53 is shown to stabilize CD45 on the membrane and is required for optimal phosphatase activity and subsequent Lck activation. Together, CD53 as a regulator of CD45 activity required for T cell immunity (PMID: 35767951). CD53 is a marker for positively selected CD4+ CD8+ thymocytes (PMID: 11867561).