CD55 Fusion Protein

Source

e coli.-derived, PGEX-4T

Tag

GST

Format

Powder

Cat no : Ag25026

Synonyms

CR; CROM; DAF; TC



Product Information

Peptide Sequence DCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVE
(35-126 aa encoded by BC001288)
Activity Not tested.
Endotoxin Level Please contact the lab for more information.
Purity70%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Formulation The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.