CD63 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CD63 Polyclonal antibody (32151-1-AP)

• KD/KO Validated

CD63 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 32151-1-AP Copied!

Publications (21)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

Synonyms

CD63 antigen, LAMP-3

• 

  WB analysis using 32151-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32151-1-AP (CD63 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of RAW 264.7 using 32151-1-AP

  WB result of CD63 antibody (32151-1-AP; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CD63 transfected RAW 264.7 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 32151-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32151-1-AP (CD63 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of NIH/3T3 using 32151-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed NIH/3T3 cells using CD63 antibody (32151-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CD63 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, RAW 264.7 cells, HUVEC cells, HeLa cells, K-562 cells
• Positive IF/ICC detected in: NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32151-1-AP targets CD63 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg2110

  Product name: Recombinant Mouse CD63 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 103-203 aa of NM_001042580.1

  Sequence: AGYVFRDQVKSEFNKSFQQQMQNYLKDNKTATILDKLQKENNCCGASNYTDWENIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGCVETIAIWLRKNI

• Full Name: CD63 antigen
• Calculated Molecular Weight: 26kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: NM_001042580.1
• Gene Symbol: Cd63
• Gene ID (NCBI): 12512
• RRID: AB_3742532
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P41731
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD63, also known as LIMP, LAMP-3, gp55, and melanoma-associated antigen (ME491), is a member of the four-times transmembrane protein superfamily (TM4SF), which constitutes a major component of lysosomal membranes. CD63 is used as a marker for exocytosis, is involved in cellular protein sorting of late endosomes and multivesicular bodies, facilitates exosome formation, and plays a role in activating ITGB1 and integrin signaling. Furthermore, CD63 is involved in intercellular adhesion through interactions with other cell surface molecules.

Publications

What published studies show

The CD63 Polyclonal antibody (Cat# 32151-1-AP) has 21 citations. These appear in journals including Theranostics, Acta Pharm Sin B, Advanced Science, Redox Biology, Journal of Nanobiotechnology, Acta Biomaterialia, ACS Applied Materials & Interfaces, and Stem Cell Research & Therapy. Research fields span exosome/extracellular vesicle biology, cancer immunotherapy, ferroptosis, pyroptosis, atherosclerosis, lung injury, and inflammation. Most studies used WB, with some IF applications, in mouse and human models.

Automatically generated from the 21 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB	J Adv Res; Podocyte-derived exosomes instruct dendritic cell-dependent CD8(+) T cell activation and proliferation in renal inflammation.; Authors - Bin Qian
mouse	WB	Redox Biol; EMAP-II from macrophage-derived extracellular vesicles drives neutrophil extracellular traps formation via PI3K/AKT/mtROS in lung ischemia/reperfusion injury; Authors - Hanhong Zhuang
mouse	WB	J Nanobiotechnology; Dual-loaded homotypic exosomes with endogenous IR808 and pH-responsive DOX drive sequenced chemo-PDT and convert "cold" OSCC tumors "hot".; Authors - He Wang
mouse	WB	Theranostics; Integrating oxygen-boosted sonodynamic therapy and ferroptosis via engineered exosomes for effective cancer treatment; Authors - Mingbo Wu
mouse	WB	Acta Pharm Sin B; Extracellular vesicles-derived hybrid biomimetic nanoplatforms camouflaged Golgi apparatus-targeted aggregation induced emission photosensitizer to elicit pyroptosis and immunogenic cell death for efficient antitumor photoimmunotherapy.; Authors - Xing Zhao
mouse	WB	Adv Sci (Weinh); USP11-PGAM5 Axis Promotes Neurotoxic Astrocyte Reactivity by Aggravating the mtDNA-cGAS-STING Pathway After Intracerebral Hemorrhage.; Authors - Jiaqing He