CD63 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CD63 Polyclonal antibody (32151-1-AP)

• 

  WB analysis using 32151-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32151-1-AP (CD63 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 32151-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32151-1-AP (CD63 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of RAW 264.7 using 32151-1-AP

  WB result of CD63 antibody (32151-1-AP; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CD63 transfected RAW 264.7 cells.

• 

  IF Staining of NIH/3T3 using 32151-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed NIH/3T3 cells using CD63 antibody (32151-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

• KD/KO Validated

CD63 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 32151-1-AP

Publications(11)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

Synonyms

CD63 antigen, LAMP-3

---

Tested Applications

• Positive WB detected in: A549 cells, RAW 264.7 cells, HUVEC cells, HeLa cells, K-562 cells
• Positive IF/ICC detected in: NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 10 publications below
• IF: See 1 publications below

Product Information

32151-1-AP targets CD63 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg2110

  Product name: Recombinant Mouse CD63 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 103-203 aa of NM_001042580.1

  Sequence: AGYVFRDQVKSEFNKSFQQQMQNYLKDNKTATILDKLQKENNCCGASNYTDWENIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGCVETIAIWLRKNI

• Full Name: CD63 antigen
• Calculated Molecular Weight: 26kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: NM_001042580.1
• Gene Symbol: Cd63
• Gene ID (NCBI): 12512
• RRID: AB_3742532
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P41731
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD63, also known as LIMP, LAMP-3, gp55, and melanoma-associated antigen (ME491), is a member of the four-times transmembrane protein superfamily (TM4SF), which constitutes a major component of lysosomal membranes. CD63 is used as a marker for exocytosis, is involved in cellular protein sorting of late endosomes and multivesicular bodies, facilitates exosome formation, and plays a role in activating ITGB1 and integrin signaling. Furthermore, CD63 is involved in intercellular adhesion through interactions with other cell surface molecules.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Adv Sci (Weinh); Pyroptosis-Inducing Engineered Microparticles for Cancer Immunotherapy.; Authors - Tianli Hao
human	WB	Int J Mol Med; Targeting of CIRP attenuates osteoarthritis progression via suppressing TLR4/NF‑κB/NLRP3 signaling axis.; Authors - Weichao Sun
mouse	WB	Theranostics; Integrating oxygen-boosted sonodynamic therapy and ferroptosis via engineered exosomes for effective cancer treatment; Authors - Mingbo Wu
mouse	WB	Adv Healthc Mater; Tumor-Resident Intracellular Bacteria Scavenger Activated In Situ Vaccines for Potent Cancer Photoimmunotherapy; Authors - Bai Lv
mouse	WB	Adv Sci (Weinh); USP11-PGAM5 Axis Promotes Neurotoxic Astrocyte Reactivity by Aggravating the mtDNA-cGAS-STING Pathway After Intracerebral Hemorrhage.; Authors - Jiaqing He
human,mouse	IF	Biol Reprod; RAB3B regulates vesicle uptake and tight junction integrity in amniotic epithelial cells and is downregulated in premature rupture of membranes.; Authors - Shuguang Su