CD63 Monoclonal antibody

CD63 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 67605-1-Ig
Clone No.3D4D1

Host / Isotype

Mouse / IgG1

Reactivity

human and More (2)

Applications

WB, IHC, IF-P, ELISA

3D4D1, CD 63, CD63 antigen, Limp1, Lysosomal-associated membrane protein 3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, U2OS cells, MCF-7 cells, A549 cells, K-562 cells, HL-60, THP-1 cells, LNCaP cells, HUVEC cells
Positive IHC detected inhuman tonsillitis tissue, human malignant melanoma tissue, human colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman tonsillitis tissue, human malignant melanoma tissue, human lymphoma tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:10000
Immunohistochemistry (IHC)IHC : 1:350-1:1400
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67605-1-Ig targets CD63 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, rat, goat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag19690

Product name: Recombinant human CD63 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 104-209 aa of BC002349

Sequence: GYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAA

Predict reactive species
Full Name CD63 molecule
Calculated Molecular Weight 26 kDa
Observed Molecular Weight 35 kDa
GenBank Accession NumberBC002349
Gene Symbol CD63
Gene ID (NCBI) 967
RRIDAB_2882811
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP08962
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD63 is a 30-60 kDa lysosomal membrane protein that belongs to the tetraspanin family. This protein plays many important roles in immuno-physiological functions. It mediate signal transduction events that play a role in the regulation of cell development, activation and motility. CD63 is expressed on activated platelets, thus it may function as a blood platelet activation marker. CD63 is a lysosomal membrane glycoprotein that is translocated to plasma membrane after platelet activation. The CD63 tetraspanin is highly expressed in the early stages of melanoma and decreases in advanced lesions, suggesting it as a possible suppressor of tumor progression. Deficiency of this protein is associated with Hermansky-Pudlak syndrome.

Protocols

Product Specific Protocols
IF protocol for CD63 antibody 67605-1-IgDownload protocol
IHC protocol for CD63 antibody 67605-1-IgDownload protocol
WB protocol for CD63 antibody 67605-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Mol Cancer

Exosomal circ_0006896 promotes AML progression via interaction with HDAC1 and restriction of antitumor immunity

Authors - Can Can
humanWB,IF

Cell Metab

Nicotinamide metabolism face-off between macrophages and fibroblasts manipulates the microenvironment in gastric cancer

Authors - Yu Jiang
human

Nat Commun

Lactate dehydrogenase A regulates tumor-macrophage symbiosis to promote glioblastoma progression

Authors - Fatima Khan
WB

Int J Oral Sci

Administration of Porphyromonas gingivalis in pregnant mice enhances glycolysis and histone lactylation/ADAM17 leading to cleft palate in offspring

Authors - Xige Zhao
humanWB

J Extracell Vesicles

124I-labelled BMSC-Derived Extracellular Vesicles Deliver CRISPR/Cas9 Ribonucleoproteins With a GFP-Reporter System to Inhibit Osteosarcoma Proliferation and Metastasis

Authors - Yujie Pan
ratIF

Bone Res

Interorgan communication in neurogenic heterotopic ossification: the role of brain-derived extracellular vesicles

Authors - Weicheng Lu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Marion (Verified Customer) (11-24-2024)

CD63 stains intracellular endosomal vesiclesd in neuronal extensions. We are satisfied with the results.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1/600
  • Cell Tissue Type: Mouse Brain
CD63 Antibody Immunofluorescence validation (1/600 dilution) in Mouse Brain (Cat no:67605-1-Ig)
FH

Guorong (Verified Customer) (03-22-2022)

Two bands at 30 and 60 kDa was detected

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: ARPE-19
CD63 Antibody Western Blot validation (1:5000 dilution) in ARPE-19 (Cat no:67605-1-Ig)
Loading...
||
New chat

Able

正在加载,请稍候...