CoraLite® Plus 488-conjugated CD63 Monoclonal antibody

CD63 Monoclonal Antibody for IF-P

Cat No. CL488-67605
Clone No.3D4D1

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

IF-P

CD63, CD63 antigen, CD63 molecule, Granulophysin, ME491, MLA1, OMA81H, Tetraspanin 30, Tspan 30, TSPAN30

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman tonsillitis tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67605 targets CD63 in IF-P applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag19690

Product name: Recombinant human CD63 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 104-209 aa of BC002349

Sequence: GYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAA

Predict reactive species
Full Name CD63 molecule
Calculated Molecular Weight 26 kDa
GenBank Accession NumberBC002349
Gene Symbol CD63
Gene ID (NCBI) 967
RRIDAB_2919508
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP08962
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CD63 is a 30-60 kDa lysosomal membrane protein that belongs to the tetraspanin family. This protein plays many important roles in immuno-physiological functions. It mediate signal transduction events that play a role in the regulation of cell development, activation and motility. CD63 is expressed on activated platelets, thus it may function as a blood platelet activation marker. CD63 is a lysosomal membrane glycoprotein that is translocated to plasma membrane after platelet activation. The CD63 tetraspanin is highly expressed in the early stages of melanoma and decreases in advanced lesions, suggesting it as a possible suppressor of tumor progression. Deficiency of this protein is associated with Hermansky-Pudlak syndrome.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 CD63 antibody CL488-67605Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...