Product Information
27563-1-PBS targets CD64 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26727 Product name: Recombinant human FCGR1A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 311-374 aa of BC032634 Sequence: VTIRKELKRKKKWDLEISLDSGHEKKVISSLQEDRHLEEELKCQEQKEEQLQEGVHRKEPQGAT Predict reactive species |
| Full Name | Fc fragment of IgG, high affinity Ia, receptor (CD64) |
| Calculated Molecular Weight | 374 aa, 43 kDa |
| Observed Molecular Weight | 65-70 kDa, 43-45 kDa |
| GenBank Accession Number | BC032634 |
| Gene Symbol | FCGR1A |
| Gene ID (NCBI) | 2209 |
| ENSEMBL Gene ID | ENSG00000150337 |
| RRID | AB_2880909 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P12314 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Fcγ receptor comprise a multigene family of integral membrane glycoproteins that exhibit complex activation or inhibitory effects on cell functions after aggregation by complexed immunoglobulin G (IgG) (PMID: 17005690 ). CD64, also known as FcγRIA, is a high affinity receptor for the Fc region of IgG. It is expressed by monocytes/macrophages, activated neutrophils, dendritic cells, and early myeloid cells (PMID: 23293080; 19642859; 7680917). CD64 functions in both innate and adaptive immune responses. The calculated molecular weight of CD64 is 43 kDa, while the glycosylated CD64 has a higher apparent molecular weight.







