Anti-Human CD68 Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of human PBMCs using 98242-1-RR (same clone as 98242-1-PBS)

  1x10^6 human PBMCs were stained with 0.25 ug Anti-Human CD68 Rabbit RecAb (98242-1-RR, Clone: 241810G1) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were then stained with CoraLite® Plus 647 Anti-Human CD14 Rabbit Recombinant Antibody (CL647-98040, Clone: 230332D7). Cells were incubated with FC Receptor Block prior to staining. Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019). This data was developed using the same antibody clone with 98242-1-PBS in a different storage buffer formulation.

• 

  FC experiment of human PBMCs using 98242-1-RR (same clone as 98242-1-PBS)

  1x10^6 human PBMCs were stained with 0.25 ug Anti-Human CD68 Rabbit RecAb (98242-1-RR, Clone: 241810G1) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were incubated with FC Receptor Block prior to staining. Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019). This data was developed using the same antibody clone with 98242-1-PBS in a different storage buffer formulation.

CD68 Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98242-1-PBS

Clone No.241810G1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

Synonyms

241810G1, CD68 molecule, GP110, Macrosialin, SCARD1

---

Product Information

98242-1-PBS targets CD68 in FC (Intra) applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2061

  Product name: Recombinant Human CD68 protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 22-319 aa of BC015557

  Sequence: NDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDRS

• Full Name: CD68 molecule
• Calculated Molecular Weight: 37 kDa
• GenBank Accession Number: BC015557
• Gene Symbol: CD68
• Gene ID (NCBI): 968
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P34810
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD68 is a type I transmembrane glycoprotein that is highly expressed by human monocytes and tissue macrophages. It belongs to the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family and primarily localizes to lysosomes and endosomes with a smaller fraction circulating to the cell surface. CD68 is also a member of the scavenger receptor family. It may play a role in phagocytic activities of tissue macrophages.