Tested Applications
Positive WB detected in | Daudi cells, Raji cells, Ramos cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:12000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
82747-4-RR targets CD79a in WB, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag17924 Product name: Recombinant human CD79A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 33-144 aa of BC113733 Sequence: LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRI Predict reactive species |
Full Name | CD79a molecule, immunoglobulin-associated alpha |
Calculated Molecular Weight | 226 aa, 25 kDa |
Observed Molecular Weight | 40 kDa |
GenBank Accession Number | BC113733 |
Gene Symbol | CD79A |
Gene ID (NCBI) | 973 |
RRID | AB_3086527 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P11912 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CD79a, also named as B-cell antigen receptor complex-associated protein alpha chain or MB-1 membrane glycoprotein, is a 226 amino acid protein, which contains one ITAM domain and one Ig-like C2-type (immunoglobulin-like) domain. CD79A is expressed in B cells and localizes in the cell membrane. CD79A is required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. CD79A is also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CD79a antibody 82747-4-RR | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |