Tested Applications
| Positive WB detected in | Raji cells, HCT 116 cells, HEK-293 cells, Jurkat cells, LPS treated THP-1 cells, Ramos cells, Daudi cells |
| Positive IHC detected in | human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human tonsillitis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:600-1:2400 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 182 publications below |
| IHC | See 1 publications below |
| IF | See 4 publications below |
| FC | See 1 publications below |
Product Information
66866-1-Ig targets CD81 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, pig, rabbit, monkey |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27298 Product name: Recombinant human CD81 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 114-199 aa of BC002978 Sequence: VNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFS Predict reactive species |
| Full Name | CD81 molecule |
| Calculated Molecular Weight | 26 kDa |
| Observed Molecular Weight | 22 kDa |
| GenBank Accession Number | BC002978 |
| Gene Symbol | CD81 |
| Gene ID (NCBI) | 975 |
| ENSEMBL Gene ID | ENSG00000110651 |
| RRID | AB_2882203 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P60033 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CD81 (also known as TAPA1 or TSPAN28) is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Many of these members are expressed on leukocytes and have been implicated in signal transduction, cell-cell interactions, and cellular activation and development. CD81 is involved in signal transduction and cell adhesion in the immune system (PMID: 9597125). CD81 has also been identified as en essential receptor for HCV (hepatitis C virus) (PMID: 21428934).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CD81 antibody 66866-1-Ig | Download protocol |
| IHC protocol for CD81 antibody 66866-1-Ig | Download protocol |
| WB protocol for CD81 antibody 66866-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Gastroenterology PTEN deficiency facilitates exosome secretion and metastasis in cholangiocarcinoma by impairing TFEB-mediated lysosome biogenesis | ||
Nat Commun A functionally tunable magnetic nanochains platform for N-glycoproteomic analysis of extracellular vesicles from ultratrace biofluids | ||
J Am Chem Soc Efficient Metabolomics Profiling from Plasma Extracellular Vesicles Enables Accurate Diagnosis of Early Gastric Cancer | ||
J Extracell Vesicles Extracellular vesicles from lung tissue drive bone marrow neutrophil recruitment in inflammation. | ||
Sci Adv Avian ANP32A incorporated in avian influenza A virions promotes interspecies transmission by priming early viral replication in mammals | ||
J Exp Clin Cancer Res Chemotherapy-elicited extracellular vesicle CXCL1 from dying cells promotes triple-negative breast cancer metastasis by activating TAM/PD-L1 signaling |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Xiaogang (Verified Customer) (10-21-2021) | I recently bought this CD81 antibody to detect CD81 from EVs purified from human and mouse cell lines. The antibody works well to detect CD81 by immunoblot.
![]() |


















