Recombinant human CD81 protein

Name: Recombinant human CD81 protein
Brand: Proteintech
SKU: Ag13036

Source

e coli.-derived, PGEX-4T

Tag

GST

Format

Liquid

Cat no : Ag13036

Synonyms

S5.7; TAPA1; TSPAN28

Validation Data Gallery View All

CD81 fusion protein Ag13036 SDS-PAGE

-/ -

Cat No. Ag13036

Freight/Packing: -

Country/Region

Size

Quantity

Please visit your regions distributor:

Request bulk or custom quote

Product Information

Peptide Sequence	MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLY (1-203 aa encoded by BC002978)
Activity	Not tested.
Endotoxin Level	Please contact the lab for more information.
Formulation	The protein was expressed as GST-tagged fusion protein by E.Coli and purified by Glutathione-sepharose. The purified protein was resolved in PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4 ) added with 15% glycerol. The elution buffer contain 100mM GSH.

Shipping and Storage

Reconstitution	Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Shipping	The product is shipped with ice packs. Upon receipt, store it immediately at -20°C to -80°C.
Stability and Storage	Aliquot and store at -20°C to -80°C for up to 6 months. Avoid freeze thaw cycles.
Storage of Reconstituted Protein	Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.

Recombinant human CD81 protein

Validation Data Gallery View All

CD81 fusion protein Ag13036 SDS-PAGE

Product Information

Shipping and Storage

Related Products

CD81 Polyclonal antibody

Anti-Human CD81 (5A6)

Biotin-conjugated CD81 Monoclonal antibody

CoraLite® Plus 405 Anti-Human CD81 (5A6)

CoraLite® Plus 488 Anti-Human CD81 (5A6)

CoraLite® Plus 488-conjugated CD81 Monoclonal antibody

Atlantic Blue™ Anti-Human CD81 (5A6)

Cardinal Red™ Anti-Human CD81 (5A6)

CoraLite® Plus 750 Anti-Human CD81 (5A6)

PE Anti-Human CD81 (5A6)

CoraLite® Plus 555 Anti-Human CD81 (5A6)

CD81 Monoclonal antibody

CD81 Monoclonal antibody, PBS Only

FITC Plus Anti-Human CD81 (5A6)

CoraLite®594 Anti-Human CD81 (5A6)

Anti-Human CD81 (5A6) Mouse IgG2a Recombinant Antibody

Anti-Human CD81 (5A6) Mouse IgG2a Recombinant Antibody, PBS Only

MultiPro® 5CFLX Anti-Human CD81 (5A6)

Anti-Human CD81 Rabbit Recombinant Antibody, PBS Only

Anti-Human CD81 Rabbit Recombinant Antibody

CoraLite® Plus 647 Anti-Human CD81 (5A6)

CD81 Recombinant antibody, PBS Only

CD81 Recombinant antibody

CD81 Recombinant antibody, PBS Only

CD81 Recombinant antibody