CD82 Polyclonal antibody

CD82 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 10248-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, ELISA

CD82, KAI1, CD 82, CD82,KAI1, IA4, Metastasis suppressor Kangai-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inK-562 cells, mouse brain tissue
Positive IHC detected inhuman tonsillitis tissue, human breast cancer tissue, human thyroid cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10248-1-AP targets CD82 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0314

Product name: Recombinant human CD82 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 35-264 aa of BC000726

Sequence: LADKSSFISVLQTSSSSLRMGAYVFIGVGAVTMLMGFLGCIGAVNEVRCLLGLYFAFLLLILIAQVTAGALFYFNMGKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENLGIILGVGVGVAIVELLGMVLSICLCRHVHSEDYSKV

Predict reactive species
Full Name CD82 molecule
Calculated Molecular Weight 30 kDa
Observed Molecular Weight 30-34 kDa
GenBank Accession NumberBC000726
Gene Symbol CD82
Gene ID (NCBI) 3732
RRIDAB_2244579
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP27701
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD82 is a membrane glycoprotein and belongs to the tetraspanin superfamily, many of which are implicated in the regulation of cell motility, morphology, fusion, signaling, fertilization, and differentiation. CD82 was originally identified as a suppressor of metastasis located on human chromosome 11p11.2 in prostate carcinoma. The majority of evidence indicates that CD82 expression is downregulated or abolished in a variety of malignant tumors. CD82 is present at high levels in human monocyte and macrophage lineages and in various epithelial cells in the prostate, lung, pancreas and many other tissues. In epithelial cells, CD82 is implicated in diverse biological processes such as cell adhesion, migration, apoptosis and morphogenesis.

Protocols

Product Specific Protocols
IHC protocol for CD82 antibody 10248-1-APDownload protocol
WB protocol for CD82 antibody 10248-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Adv Biol (Weinh)

Tetraspanin CD82 Associates with Trafficking Vesicle in Muscle Cells and Binds to Dysferlin and Myoferlin

Authors - Tatiana Fontelonga
humanWB

Oncol Lett

MicroRNA-633 enhances melanoma cell proliferation and migration by suppressing KAI1.

Authors - Zhengxiang Wang
humanIHC

Asian Pac J Cancer Prev

Down Regulation of KAI1/CD82 in Lymph Node Positive and Advanced T-Stage Group in Breast Cancer Patients.

Authors - Thammineni Krishna Latha
mouseWB

Parasit Vectors

Quantitative proteomic analysis of local and systemic extracellular vesicles during Eimeria falciformis infectious cycle in the host

Authors - Joshua Seun Olajide
Loading...
||
New chat Able
正在加载,请稍候...