Tested Applications
| Positive FC detected in | human PBMCs |
Recommended dilution
| Application | Dilution |
|---|---|
| Flow Cytometry (FC) | FC : 5 ul per 10^6 cells in a 100 µl suspension |
| This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL594-98278 targets CD82 in FC applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg1749 Product name: Recombinant Human CD82 protein (rFc Tag) (HPLC verified) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 111-228 aa of NM_002231.4 Sequence: GKLKQEMGGIVTELIRDYNSSREDSLQDAWDYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRKGFCEAPGNRTQSGNHPEDWPVYQEGCMEKVQAWLQENL Predict reactive species |
| Full Name | CD82 molecule |
| Calculated Molecular Weight | 30 kDa |
| GenBank Accession Number | NM_002231.4 |
| Gene Symbol | CD82 |
| Gene ID (NCBI) | 3732 |
| Conjugate | CoraLite®594 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
| Excitation Laser | Yellow-Green Laser (561 nm) |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P27701-1 |
| Storage Buffer | PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. |
Background Information
CD82 is a membrane glycoprotein and belongs to the tetraspanin superfamily, many of which are implicated in the regulation of cell motility, morphology, fusion, signaling, fertilization, and differentiation. CD82 was originally identified as a suppressor of metastasis located on human chromosome 11p11.2 in prostate carcinoma. The majority of evidence indicates that CD82 expression is downregulated or abolished in a variety of malignant tumors. CD82 is present at high levels in human monocyte and macrophage lineages and in various epithelial cells in the prostate, lung, pancreas and many other tissues. In epithelial cells, CD82 is implicated in diverse biological processes such as cell adhesion, migration, apoptosis and morphogenesis.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CL594 CD82 antibody CL594-98278 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
