Tested Applications
| Positive WB detected in | Raji cells, Daudi cells, PNGF treated Daudi cells, PNGF treated Raji cells |
| Positive IHC detected in | human tonsillitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27873-1-AP targets CD83 in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27467 Product name: Recombinant human CD83 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 22-144 aa of BC030830 Sequence: EVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAE Predict reactive species |
| Full Name | CD83 molecule |
| Calculated Molecular Weight | 205 aa, 23 kDa |
| Observed Molecular Weight | 37-50kDa, 23kDa |
| GenBank Accession Number | BC030830 |
| Gene Symbol | CD83 |
| Gene ID (NCBI) | 9308 |
| ENSEMBL Gene ID | ENSG00000112149 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q01151 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CD83 is a member of the immunoglobulin (Ig) superfamily, consisting of an extracellular V-type Ig-like domain, a transmembrane domain, and a cytoplasmic tail. CD83 is one of the most prominent markers for fully matured dendritic cells (DCs) (PMID: 17334966). It is also found on the surface of other activated hematopoietic cells, including lymphocytes, monocytes, macrophages, and neutrophils (PMID: 31231400; 17334966). CD83 regulates the maturation, activation, and homeostasis of numerous immune cells (PMID: 31231400; 32362900). CD83 can also expressed as a soluble form. Soluble CD83 can bind to DCs and inhibit their maturation (PMID: 17334966; 12403928). PNGase F (peptide N-glycosidase F) digestion reduced the 37 and 50 kDa CD83 forms to 28 kDa (PMID: 15320871).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CD83 antibody 27873-1-AP | Download protocol |
| WB protocol for CD83 antibody 27873-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





