CD9 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84142-1-RR (same clone as 84142-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84142-1-RR (CD9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84142-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 84142-1-RR (same clone as 84142-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84142-1-RR (CD9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84142-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 84142-1-RR (same clone as 84142-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 84142-1-RR (CD9 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84142-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 84142-1-RR (same clone as 84142-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 84142-1-RR (CD9 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84142-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 84142-1-RR (same clone as 84142-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using CD9 antibody (84142-1-RR, Clone: 240830A8 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 84142-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84142-1-RR

  Biolayer interferometry (BLl) kinetic assays of 84142-1-RR against Human CD9 were performed. The affinity constant is 6.21 nM.

CD9 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 84142-1-PBS

Clone No.240830A8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

240830A8, 5H9, 5H9 antigen, BA2, BTCC 1

---

Product Information

84142-1-PBS targets CD9 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1037

  Product name: recombinant human CD9 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 112-195 aa of NM_001769.4

  Sequence: SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI

• Full Name: CD9 molecule
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: NM_001769.4
• Gene Symbol: CD9
• Gene ID (NCBI): 928
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P21926
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The cell-surface molecule CD9, a member of the transmembrane-4 superfamily, interacts with the integrin family and other membrane proteins, and is postulated to participate in cell migration and adhesion. Expression of CD9 enhances membrane fusion between muscle cells and promotes viral infection in some cells (PMID:10459022). It is often used as a mesenchymal stem cell marker (PMID:18005405). The CD9 antigen appears to be a 227-amino acid molecule with four hydrophobic domains and one N-glycosylation site (PMID: 1840589). This antibody detects bands of 23-30 kDa, which may be due to the difference in glycosylations (PMID: 8701996).