Tested Applications
| Positive WB detected in | pig brain tissue, mouse brain tissue, rat brain tissue |
| Positive IHC detected in | human colon cancer tissue, human lung cancer tissue, mouse spleen tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27178-1-AP targets CD90 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25603 Product name: Recombinant human CD90 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 20-80 aa of BC065559 Sequence: QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNF Predict reactive species |
| Full Name | Thy-1 cell surface antigen |
| Calculated Molecular Weight | 161 aa, 18 kDa |
| Observed Molecular Weight | 26 kDa |
| GenBank Accession Number | BC065559 |
| Gene Symbol | CD90/Thy1 |
| Gene ID (NCBI) | 7070 |
| RRID | AB_3085933 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P04216 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CD90, also known as THY1, is a 25-35 kD protein that is expressed on 1-4% of human fetal liver cells, cord blood cells, and bone marrow cells. CD90 is one of the essential surface molecules expressed on human MSC from bone marrow and other sources. Activation of Thy-1 has been reported to promote T cell activation. It also affects numerous nonimmunologic biological processes, including cellular adhesion, neurite outgrowth, tumor growth, migration, and cell death.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CD90 antibody 27178-1-AP | Download protocol |
| WB protocol for CD90 antibody 27178-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CD90 (THY1) polyclonal antibody (Cat# 27178-1-AP) has 22 citations. These appear in journals including Bioactive Materials, Nature Communications, ACS Nano, Advanced Science, Biomaterials, Materials Today Bio, Journal of Orthopaedic Translation, International Journal of Biological Macromolecules, International Journal of Nanomedicine, Biochemical Pharmacology, Dental Materials, Mediators of Inflammation, Translational Oncology, Stem Cells, Frontiers in Bioscience, Journal of Endocrinological Investigation, Molecular Immunology, Neurogastroenterology & Motility, and Journal of Gastroenterology and Hepatology. Research fields span bone regeneration, stem cells, immunology, cancer, and dentistry.
| Species | Application | Title |
|---|---|---|
Bioact Mater Mechanism and regulatory strategy study on promoting vascularized bone regeneration via intracellular zinc ion transport | ||
Bioact Mater Sequential simulation of regeneration-specific microenvironments using scaffolds loaded with nanoplatelet vesicles enhances bone regeneration | ||
Nat Commun Injectable ECM-mimetic dynamic hydrogels abolish ferroptosis-induced post-discectomy herniation through delivering nucleus pulposus progenitor cell-derived exosomes | ||
Nat Commun CD142-positive synovial fibroblasts drive meniscus destruction in rheumatoid arthritis | ||
ACS Nano Micronano Titanium Accelerates Mesenchymal Stem Cells Aging through the Activation of Senescence-Associated Secretory Phenotype | ||
Adv Sci (Weinh) A Wireless 3D Magneto-Mechanical Stimulation Platform Drives In Situ Chondrogenic Commitment of Endogenous MSCs. |
Reviews
What customers say
The single review for this CD90 antibody reports successful use in immunofluorescence on PFA-fixed human renal mesangial cells at a 1:50 dilution. The reviewer combined it with an AF488-conjugated donkey anti-rabbit IgG secondary antibody, a Star Red membrane probe, and DAPI, and shared paired images with and without the membrane probe. The product received a 5-star rating, indicating strong satisfaction with its staining performance in this application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Christelle (Verified Customer) (01-06-2025) | Immunofluorescent analysis of (PFA 4%) fixed human renal mesangial cells using CD90 antibody (27178-1-AP) at dilution of 1:50 and AF488-Conjugated Donkey Anti-Rabbit IgG (Life Technologies), Star Red membrane probe (Abberior, yellow) and DAPI (blue). 2 files uploaded : 1 aquisition without the membrane probe and the same aquisition with the membrane probe.
 |
