Tested Applications
Positive WB detected in | pig brain tissue, mouse brain tissue, rat brain tissue |
Positive IHC detected in | human colon cancer tissue, human lung cancer tissue, mouse spleen tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:10000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
IF | See 10 publications below |
Product Information
27178-1-AP targets CD90 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
Tested Reactivity | human, mouse, rat, pig |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25603 Product name: Recombinant human CD90 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 20-80 aa of BC065559 Sequence: QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNF Predict reactive species |
Full Name | Thy-1 cell surface antigen |
Calculated Molecular Weight | 161 aa, 18 kDa |
Observed Molecular Weight | 26 kDa |
GenBank Accession Number | BC065559 |
Gene Symbol | CD90/Thy1 |
Gene ID (NCBI) | 7070 |
RRID | AB_3085933 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P04216 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CD90, also known as THY1, is a 25-35 kD protein that is expressed on 1-4% of human fetal liver cells, cord blood cells, and bone marrow cells. CD90 is one of the essential surface molecules expressed on human MSC from bone marrow and other sources. Activation of Thy-1 has been reported to promote T cell activation. It also affects numerous nonimmunologic biological processes, including cellular adhesion, neurite outgrowth, tumor growth, migration, and cell death.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CD90 antibody 27178-1-AP | Download protocol |
IHC protocol for CD90 antibody 27178-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Commun Injectable ECM-mimetic dynamic hydrogels abolish ferroptosis-induced post-discectomy herniation through delivering nucleus pulposus progenitor cell-derived exosomes | ||
J Orthop Translat Osteostaticytes: A novel osteoclast subset couples bone resorption and bone formation | ||
Stem Cells Nicotinamide riboside modulates HIF-1 signaling to maintain and enhance odontoblastic differentiation in human dental pulp stem cells | ||
Transl Oncol A machine learning-based prognostic signature utilizing MSC proteomics for predicting bladder cancer prognosis and treatment response | ||
Neurogastroenterol Motil Construction and identification of an immortalized rat intestinal smooth muscle cell line. | ||
ACS Nano Micronano Titanium Accelerates Mesenchymal Stem Cells Aging through the Activation of Senescence-Associated Secretory Phenotype |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Christelle (Verified Customer) (01-06-2025) | Immunofluorescent analysis of (PFA 4%) fixed human renal mesangial cells using CD90 antibody (27178-1-AP) at dilution of 1:50 and AF488-Conjugated Donkey Anti-Rabbit IgG (Life Technologies), Star Red membrane probe (Abberior, yellow) and DAPI (blue). 2 files uploaded : 1 aquisition without the membrane probe and the same aquisition with the membrane probe.
![]() |