CD90 Polyclonal antibody

CD90 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27178-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF, ELISA

CD90 / Thy1, THY1, Thy 1 antigen, Thy 1 cell surface antigen, Thy 1 membrane glycoprotein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inpig brain tissue, mouse brain tissue, rat brain tissue
Positive IHC detected inhuman colon cancer tissue, human lung cancer tissue, mouse spleen tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IFSee 11 publications below

Product Information

27178-1-AP targets CD90 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25603

Product name: Recombinant human CD90 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 20-80 aa of BC065559

Sequence: QKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNF

Predict reactive species
Full Name Thy-1 cell surface antigen
Calculated Molecular Weight 161 aa, 18 kDa
Observed Molecular Weight26 kDa
GenBank Accession NumberBC065559
Gene Symbol CD90/Thy1
Gene ID (NCBI) 7070
RRIDAB_3085933
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP04216
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD90, also known as THY1, is a 25-35 kD protein that is expressed on 1-4% of human fetal liver cells, cord blood cells, and bone marrow cells. CD90 is one of the essential surface molecules expressed on human MSC from bone marrow and other sources. Activation of Thy-1 has been reported to promote T cell activation. It also affects numerous nonimmunologic biological processes, including cellular adhesion, neurite outgrowth, tumor growth, migration, and cell death.

Protocols

Product Specific Protocols
IHC protocol for CD90 antibody 27178-1-APDownload protocol
WB protocol for CD90 antibody 27178-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

Bioact Mater

Mechanism and regulatory strategy study on promoting vascularized bone regeneration via intracellular zinc ion transport

Authors - Yitong Liu
ratIF

Nat Commun

Injectable ECM-mimetic dynamic hydrogels abolish ferroptosis-induced post-discectomy herniation through delivering nucleus pulposus progenitor cell-derived exosomes

Authors - Wenkai Wang
mouseIF

J Orthop Translat

Osteostaticytes: A novel osteoclast subset couples bone resorption and bone formation

Authors - Zhiyuan Wei
humanIF

Stem Cells

Nicotinamide riboside modulates HIF-1 signaling to maintain and enhance odontoblastic differentiation in human dental pulp stem cells

Authors - Peimeng Zhan
humanIF

Transl Oncol

A machine learning-based prognostic signature utilizing MSC proteomics for predicting bladder cancer prognosis and treatment response

Authors - Xinyu Zhang
ratIF

Neurogastroenterol Motil

Construction and identification of an immortalized rat intestinal smooth muscle cell line.

Authors - Huiling Chen

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Christelle (Verified Customer) (01-06-2025)

Immunofluorescent analysis of (PFA 4%) fixed human renal mesangial cells using CD90 antibody (27178-1-AP) at dilution of 1:50 and AF488-Conjugated Donkey Anti-Rabbit IgG (Life Technologies), Star Red membrane probe (Abberior, yellow) and DAPI (blue). 2 files uploaded : 1 aquisition without the membrane probe and the same aquisition with the membrane probe.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:50
  • Cell Tissue Type: Human Renal Mesangial Cells (HRMC, primary cells)
CD90 Antibody Immunofluorescence validation (1:50 dilution) in Human Renal Mesangial Cells (HRMC, primary cells) (Cat no:27178-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...