CD99L2 Polyclonal antibody

• 

  WB analysis of HUVEC using 13732-1-AP

  HUVEC cells were subjected to SDS PAGE followed by western blot with 13732-1-AP (CD99L2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

CD99L2 Polyclonal Antibody for WB, ELISA

Cat No. 13732-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

UNQ1964/PRO4486, MIC2-like protein 1, MIC2L1, CD99B, CD99 antigen-like protein 2

---

Tested Applications

• Positive WB detected in: HUVEC cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13732-1-AP targets CD99L2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3809

  Product name: Recombinant human CD99L2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 18-113 aa of BC025729

  Sequence: TLVQRGSGDFDDFNLEDAVKETSSVKPALGMYHKLDGLKQQNFILSLFWMLEVLYQGVGWATFSLKALGKNLSLTFPTSGGSRCSLVCGCITPISA

• Full Name: CD99 molecule-like 2
• Calculated Molecular Weight: 262 aa, 28 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC025729
• Gene Symbol: CD99L2
• Gene ID (NCBI): 83692
• RRID: AB_3669170
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TCZ2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD99L2 (CD99 molecule like 2), also known as CD99B and MIC2L1, is a type 1 transmembrane protein that is similar to CD99 (PMID: 12706889). It is expressed on most leukocytes and several other cell types including neuronal cells (PMID: 12706889). CD99L2 may function as a homophilic adhesion molecule as well as play a role in a late step of leukocyte extravasation helping cells to overcome the endothelial basement membrane (PMID: 37199607). Its related pathways respond to elevated platelet cytosolic Ca2+ and cell surface interactions at the vascular wall.