TSPYL2/CDA1 Polyclonal antibody, PBS Only

• 

  WB analysis of HeLa using 12087-2-AP (same clone as 12087-2-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 12087-2-AP (TSPYL2/CDA1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12087-2-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 12087-2-AP (same clone as 12087-2-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 12087-2-AP (TSPYL2/CDA1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12087-2-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 12087-2-AP (same clone as 12087-2-PBS)

  MCF7 cells were subjected to SDS PAGE followed by western blot with 12087-2-AP (TSPYL2/CDA1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12087-2-PBS in a different storage buffer formulation.

• 

  WB analysis of DU 145 using 12087-2-AP (same clone as 12087-2-PBS)

  DU 145 cells were subjected to SDS PAGE followed by western blot with 12087-2-AP (TSPYL2/CDA1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12087-2-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 12087-2-AP (same clone as 12087-2-PBS)

  IP result of anti-TSPYL2/CDA1 (IP:12087-2-AP, 4ug; Detection:12087-2-AP 1:1000) with HEK-293 cells lysate 1000ug. This data was developed using the same antibody clone with 12087-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 12087-2-AP (same clone as 12087-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 12087-2-AP (TSPYL2/CDA1 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 12087-2-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 12087-2-AP (same clone as 12087-2-PBS)

  Immunofluorescent analysis of Hela cells, using TSPYL2/CDA1 antibody 12087-2-AP at 1:50 dilution and FITC-labeled donkey anti-rabbit IgG (green). Blue pseudocolor = DAPI (fluorescent DNA dye). This data was developed using the same antibody clone with 12087-2-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TSPYL2/CDA1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 12087-2-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

CDA1, TSPX, TSPYL2, Cell division autoantigen 1, CINAP

---

Product Information

12087-2-PBS targets TSPYL2/CDA1 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2722

  Product name: Recombinant human TSPYL2,TSPX,NP79 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 344-693 aa of BC024270

  Sequence: WHRGQEPQARRHGNQDASHSFFSWFSNHSLPEADRIAEIIKNDLWVNPLRYYLRERGSRIKRKKQEMKKRKTRGRCEVVIMEDAPDYYAVEDIFSEISDIDETIHDIKISDFMETTDYFETTDNEITDINENICDSENPDHNEVPNNETTDNNESADDHETTDNNESADDNNENPEDNNKNTDDNEENPNNNENTYGNNFFKGGFWGSHGNNQDSSDSDNEADEASDDEDNDGNEGDNEGSDDDGNEGDNEGSDDDDRDIEYYEKVIEDFDKDQADYEDVIEIISDESVEEEGIEEGIQQDEDIYEEGNYEEEGSEDVWEEGEDSDDSDLEDVLQVPNGWANPGKRGKTG

• Full Name: TSPY-like 2
• Calculated Molecular Weight: 693 aa, 79 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: BC024270
• Gene Symbol: CDA1
• Gene ID (NCBI): 64061
• RRID: AB_2256811
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H2G4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TSPYL2 (also known as CINAP, CDA1, TSPX or DENTT) is a new member of the nucleosome assembly protein superfamily. TSPYL2 binds histones and facilitates nucleosome assembly. TSPYL2 is expressed in various tissues, highly in the pituitary gland and moderately in the adrenals, brain, testis, and ovary. Immunohistochemical staining analysis for TSPYL2 showed differential cytoplasmic and nuclear staining patterns in several cell types. Downregulated expression of TSPYL2 has been observed in several tumors, which suggests its role as a tumor suppressor. Although it is predicted that TSPYL2 has a molecular mass of 79.43 kDa, it is found that mammalian TSPYL2 appears at a size of 120 kDa by western blot analysis. The abundant acidic amino acid regions in TSPYL2 may cause its aberrant migration. In addition, the TSPYL2 protein is unstable and sensitive to proteasomal degradation.