Tested Applications
Positive WB detected in | Caco-2 cells, HeLa cells, Jurkat cells |
Positive IHC detected in | human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 1 publications below |
IHC | See 1 publications below |
CoIP | See 1 publications below |
Product Information
28178-1-AP targets CDC123/C10orf7 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26828 Product name: Recombinant human CDC123 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 289-318 aa of BC001600 Sequence: CTNSEVTVQPSPYLSYRLPKDFVDLSTGED Predict reactive species |
Full Name | cell division cycle 123 homolog (S. cerevisiae) |
Calculated Molecular Weight | 39 kDa |
Observed Molecular Weight | 35-39 kDa |
GenBank Accession Number | BC001600 |
Gene Symbol | CDC123 |
Gene ID (NCBI) | 8872 |
RRID | AB_2881081 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O75794 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CDC123/C10orf7 antibody 28178-1-AP | Download protocol |
IHC protocol for CDC123/C10orf7 antibody 28178-1-AP | Download protocol |
IF protocol for CDC123/C10orf7 antibody 28178-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |