Tested Applications
| Positive WB detected in | Caco-2 cells, HeLa cells, Jurkat cells |
| Positive IHC detected in | human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 1 publications below |
| IHC | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
28178-1-AP targets CDC123/C10orf7 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26828 Product name: Recombinant human CDC123 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 289-318 aa of BC001600 Sequence: CTNSEVTVQPSPYLSYRLPKDFVDLSTGED Predict reactive species |
| Full Name | cell division cycle 123 homolog (S. cerevisiae) |
| Calculated Molecular Weight | 39 kDa |
| Observed Molecular Weight | 35-39 kDa |
| GenBank Accession Number | BC001600 |
| Gene Symbol | CDC123 |
| Gene ID (NCBI) | 8872 |
| RRID | AB_2881081 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O75794 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CDC123/C10orf7 antibody 28178-1-AP | Download protocol |
| IHC protocol for CDC123/C10orf7 antibody 28178-1-AP | Download protocol |
| WB protocol for CDC123/C10orf7 antibody 28178-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







