CDC123/C10orf7 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CDC123/C10orf7 Polyclonal antibody (28178-1-AP)

• Featured Product
• KD/KO Validated

CDC123/C10orf7 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 28178-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, CoIP, ELISA

Synonyms

CDC123, C10orf7, D123, HT 1080, HT-1080

• 

  WB analysis using 28178-1-AP

  Caco-2 cells were subjected to SDS PAGE followed by western blot with 28178-1-AP (CDC123/C10orf7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 28178-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 28178-1-AP (CDC123/C10orf7 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach using 28178-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 28178-1-AP (CDC123/C10orf7 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 28178-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using 28178-1-AP (CDC123/C10orf7 antibody) at dilution of 1:50 and Alexa Fluor 488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: Caco-2 cells, HeLa cells, Jurkat cells
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28178-1-AP targets CDC123/C10orf7 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26828

  Product name: Recombinant human CDC123 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 289-318 aa of BC001600

  Sequence: CTNSEVTVQPSPYLSYRLPKDFVDLSTGED

• Full Name: cell division cycle 123 homolog (S. cerevisiae)
• Calculated Molecular Weight: 39 kDa
• Observed Molecular Weight: 35-39 kDa
• GenBank Accession Number: BC001600
• Gene Symbol: CDC123
• Gene ID (NCBI): 8872
• RRID: AB_2881081
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75794
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC,CoIP	Pathol Res Pract; CDC123 promotes Hepatocellular Carcinoma malignant progression by regulating CDKAL1; Authors - Yong Wang ; KD Validated