Tested Applications
| Positive WB detected in | SMMC-7721 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below | 
Product Information
25187-1-AP targets CDC14B in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human | 
| Cited Reactivity | human | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag18227 Product name: Recombinant human CDC14B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 349-498 aa of BC156666 Sequence: PGSVIGPQQQFLVMKQTNLWLEGDYFRQKLKGQENGQHRAAFSKLLSGVDDISINGVENQDQQEPEPYSDDDEINGVTQGDRLRALKSRRQSKTNAIPLTVILQSSVQSCKTSEPNISGSAGITKRTTRSASRKSSVKSLSISRTKTVLR Predict reactive species | 
                                    
| Full Name | CDC14 cell division cycle 14 homolog B (S. cerevisiae) | 
| Calculated Molecular Weight | 498 aa, 57 kDa | 
| Observed Molecular Weight | 56 kDa | 
| GenBank Accession Number | BC156666 | 
| Gene Symbol | CDC14B | 
| Gene ID (NCBI) | 8555 | 
| RRID | AB_2879949 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | O60729 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for CDC14B antibody 25187-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 

