CDC20 Polyclonal antibody

• 

  WB analysis using 30451-1-AP

  THP-1 cells were subjected to SDS PAGE followed by western blot with 30451-1-AP (CDC20 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 30451-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 30451-1-AP (CDC20 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of U2OS using 30451-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed U2OS cells using CDC20 antibody (30451-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of HEK-293 using 30451-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using CDC20 antibody (30451-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

• 

  IF Staining of HeLa using 30451-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CDC20 antibody (30451-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

CDC20 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 30451-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

bA276H19.3, CDC20, CDC20A, p55CDC

---

Tested Applications

• Positive WB detected in: THP-1 cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U2OS cells, HEK-293 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30451-1-AP targets CDC20 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32712

  Product name: Recombinant human CDC20 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-176 aa of BC001088

  Sequence: MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRIL

• Full Name: cell division cycle 20 homolog (S. cerevisiae)
• Calculated Molecular Weight: 55 kDa
• Observed Molecular Weight: 51 kDa
• GenBank Accession Number: BC001088
• Gene Symbol: CDC20
• Gene ID (NCBI): 991
• RRID: AB_3086319
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q12834
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cdc20 (Cell-division cycle protein 20 homologue) is also named as p55CDC and belongs to the WD repeat CDC20/Fizzy family. Cdc20 has important functions in chromosome segregation and mitotic exit. Cdc20 is the target of the spindle assembly checkpoint (SAC) and a key cofactor of the anaphase-promoting complex or cyclosome (APC/CCDC20) E3 ubiquitin ligase, thus regulating APC/C ubiquitin activity on specific substrates for their subsequent degradation by the proteasome (PMID: 28202332). The 55-kDa band corresponded to the size of Cdc20 (PMID: 22566641).