CDK10 Polyclonal antibody

• 

  WB analysis using 30061-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30061-1-AP (CDK10 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IF Staining of hTERT-RPE1 using 30061-1-AP

  Immunofluorescent analysis of (4% PFA) fixed hTERT-RPE1 cells using CDK10 antibody (30061-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CoraLite®594 ARL13B antibody (CL594-17711, red).

CDK10 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 30061-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

Synonyms

Serine/threonine-protein kinase PISSLRE, EC:2.7.11.22, Cyclin-dependent kinase 10, Cyclin dependent kinase 10

---

Tested Applications

• Positive WB detected in: A431 cells, K-562 cells, THP-1 cells, U2OS cells, C2C12 cells
• Positive IF/ICC detected in: hTERT-RPE1 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

30061-1-AP targets CDK10 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30365

  Product name: Recombinant human CDK10 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 190-283 aa of BC017342

  Sequence: NIWPGFSKLPLVGQYSLRKQPYNNLKHKFPWLSEAGLRLLHFLFMATAGDCLESSYFKEKPLPCEPELMPTFPHHRNKRAAPATSEGQSKRCKP

• Full Name: cyclin-dependent kinase 10
• Calculated Molecular Weight: 283 aa, 32 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC017342
• Gene Symbol: CDK10
• Gene ID (NCBI): 8558
• RRID: AB_2935507
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15131
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cyclin-dependent kinase 10 (CDK10) is a Cdc2-related kinase that was discovered based on its homology to the Cdc2 PSTA1RE amino acid domain (PMID: 8208557). CDK10 plays a pivotal role in the regulation of fundamental cellular processes, including cell proliferation, transcription regulation, and cell cycle regulation. It partners with cyclin M to phosphorylate substrates such as ETS2 and PKN2 in order to modulate cellular growth. Initial reports have indicated that CDK10 may act as a tumor suppressor in breast cancer (PMID: 26392360). Additional studies have demonstrated tumor suppressive and oncogenic roles for CDK10 in malignancies such as hepatobiliary cancers, gastric cancer, glioma, nasopharyngeal carcinoma, and colorectal cancer(PMID: 22326270, PMID: 29512714, PMID: 23740091, PMID: 29845196)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	EMBO Rep; HDAC6 deacetylates ENKD1 to regulate mitotic spindle behavior and corneal epithelial homeostasis; Authors - Ting Song