Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, HepG2 cells, Jurkat cells, U-251 cells, mouse ovary tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
29214-1-AP targets CDK17 in WB, ELISA applications and shows reactivity with Human, Mouse samples.
| Tested Reactivity | Human, Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30200 Product name: Recombinant human CDK17 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-100 aa of NM_002595 Sequence: MKKFKRRLSLTLRGSQTIDESLSELAEQMTIEENSSKDNEPIVKNGRPPTSHSMHSFLHQYTGSFKKPPLRRPHSVIGGSLGSFMAMPRNGSRLDIVHEN Predict reactive species |
| Full Name | PCTAIRE protein kinase 2 |
| Calculated Molecular Weight | 60 kDa |
| Observed Molecular Weight | 60 kDa |
| GenBank Accession Number | NM_002595 |
| Gene Symbol | CDK17 |
| Gene ID (NCBI) | 5128 |
| RRID | AB_2935472 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q00537 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cyclin-dependent kinase 17 (CDK17) belongs to the protein kinase superfamily. It may play a role in terminally differentiated neurons and has a Ser/Thr-phosphorylating activity for histone H1. CDK17 can be detected as 60 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CDK17 antibody 29214-1-AP | Download protocol |
| WB protocol for CDK17 antibody 29214-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

