Product Information
83635-2-PBS targets CDK2 in WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA applications and shows reactivity with human, rat samples.
Tested Reactivity | human, rat |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag17133 Product name: Recombinant human CDK2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 217-298 aa of BC003065 Sequence: RTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL Predict reactive species |
Full Name | cyclin-dependent kinase 2 |
Calculated Molecular Weight | 298 aa, 34 kDa |
Observed Molecular Weight | 30-33 kDa |
GenBank Accession Number | BC003065 |
Gene Symbol | CDK2 |
Gene ID (NCBI) | 1017 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P24941 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
CDK2(Cyclin-dependent kinase 2) is also named as CDKN2 and belongs to the protein kinase superfamily,CMGC Ser/Thr protein kinase family, CDC2/CDKX subfamily.It is involved in the control of the cell cycle; essential for meiosis, but dispensable for mitosis.It has 2 isoforms produced by alternative splicing.