Product Information
83635-2-PBS targets CDK2 in WB, IHC, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag17133 Product name: Recombinant human CDK2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 217-298 aa of BC003065 Sequence: RTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL Predict reactive species |
| Full Name | cyclin-dependent kinase 2 |
| Calculated Molecular Weight | 298 aa, 34 kDa |
| Observed Molecular Weight | 30-33 kDa |
| GenBank Accession Number | BC003065 |
| Gene Symbol | CDK2 |
| Gene ID (NCBI) | 1017 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P24941 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
CDK2(Cyclin-dependent kinase 2) is also named as CDKN2 and belongs to the protein kinase superfamily,CMGC Ser/Thr protein kinase family, CDC2/CDKX subfamily.It is involved in the control of the cell cycle; essential for meiosis, but dispensable for mitosis.It has 2 isoforms produced by alternative splicing.













