CDK5 Polyclonal antibody

• 

  WB analysis using 10430-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10430-1-AP (CDK5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 10430-1-AP

  N/A

• 

  WB analysis of mouse pancreas using 10430-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 10430-1-AP (CDK5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 10430-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 10430-1-AP (CDK5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 10430-1-AP

  IP result of anti-CDK5 (IP:10430-1-AP, 4ug; Detection:10430-1-AP 1:3000) with mouse brain tissue lysate 2120 ug.

• 

  IHC staining of mouse kidney using 10430-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 10430-1-AP (CDK5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 10430-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 10430-1-AP (CDK5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 10430-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 10430-1-AP (CDK5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 10430-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 10430-1-AP (CDK5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human renal cell carcinoma using 10430-1-AP

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 10430-1-AP (CDK5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human renal cell carcinoma using 10430-1-AP

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 10430-1-AP (CDK5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of SH-SY5Y using 10430-1-AP

  Immunofluorescent analysis of (4% PFA) fixed SH-SY5Y cells using CDK5 antibody (10430-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

• Featured Product
• KD/KO Validated

CDK5 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10430-1-AP

Publications(21)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Cdk 5, Cyclin-dependent kinase 5, Cyclin-dependent-like kinase 5, EC:2.7.11.1, PSSALRE

---

Tested Applications

• Positive WB detected in: HepG2 cells, HCT 116 cells, mouse pancreas tissue, NIH/3T3 cells, WB result of CDK5 antibody (10430-1-AP; 1:1000; room temperature for 1.5 hours) with wild-type and CDK5 knockout HCT 116 cells., mouse brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: mouse kidney tissue, human renal cell carcinoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 19 publications below
• IHC: See 1 publications below
• IF: See 1 publications below
• IP: See 1 publications below

Product Information

10430-1-AP targets CDK5 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0686

  Product name: Recombinant human CDK5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 92-273 aa of BC005115

  Sequence: DSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQ

• Full Name: cyclin-dependent kinase 5
• Calculated Molecular Weight: 31 kDa, 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC005115
• Gene Symbol: CDK5
• Gene ID (NCBI): 1020
• RRID: AB_2078859
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q00535
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cyclin-dependent kinase 5 (CDK5), belongs to the cyclin-dependent kinase family, is a proline-directed serine/threonine-protein kinase that essential for neuronal cell cycle arrest and differentiation and may be involved in apoptotic cell death in neuronal diseases by triggering abortive cell cycle re-entry. CDK5 predominantly expressed in neurons where it phosphorylates both high molecular weight neurofilaments and microtubule-associated protein tau.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Signal Transduct Target Ther; SARS-CoV-2 hijacks cellular kinase CDK2 to promote viral RNA synthesis; Authors - Saisai Guo
mouse	WB	Neuropharmacology; Inhibition of Cdk5 rejuvenates inhibitory circuits and restores experience-dependent plasticity in adult visual cortex.; Authors - Yue Li ; KD Validated
human	WB	Cells; Phosphorylation-Induced Ubiquitination and Degradation of PXR through CDK2-TRIM21 Axis.; Authors - Mengyao Qin ; KD Validated
human	WB	Am J Transl Res; Hypoxia induces HT-22 neuronal cell death via Orai1/CDK5 pathway-mediated Tau hyperphosphorylation.; Authors - Binbin Fang
mouse	WB	J Cell Biochem; Nestin protects mouse podocytes against high glucose-induced apoptosis by a Cdk5-dependent mechanism.; Authors - Liu Wei W
mouse,human	WB	BMC Neurol; The LPA-CDK5-tau pathway mediates neuronal injury in an in vitro model of ischemia-reperfusion insult.; Authors - Yaya Wang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

XinN (Verified Customer) (02-27-2023)

It can recognize endogenous CDK5 with a right MW.

• Applications: Western Blot
• Primary Antibody Dilution: 1:2000
• Cell Tissue Type: mouse brain lysate

CDK5 Antibody Western Blot validation (1:2000 dilution) in mouse brain lysate (Cat no:10430-1-AP)

FH

Kathryn (Verified Customer) (04-22-2022)

This CDK5 antibody works very well to stain the nuclei of developed mouse oocytes.

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:100
• Cell Tissue Type: Mouse ovary sections

CDK5 Antibody Immunofluorescence validation (1:100 dilution) in Mouse ovary sections (Cat no:10430-1-AP)