• Featured Product
  • KD/KO Validated

CDK5 Polyclonal antibody

CDK5 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 10430-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Cdk 5, Cyclin-dependent kinase 5, Cyclin-dependent-like kinase 5, EC:2.7.11.1, PSSALRE

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, HCT 116 cells, mouse pancreas tissue, NIH/3T3 cells, WB result of CDK5 antibody (10430-1-AP; 1:1000; room temperature for 1.5 hours) with wild-type and CDK5 knockout HCT 116 cells., mouse brain tissue
Positive IP detected inmouse brain tissue
Positive IHC detected inmouse kidney tissue, human renal cell carcinoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10430-1-AP targets CDK5 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0686

Product name: Recombinant human CDK5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 92-273 aa of BC005115

Sequence: DSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQ

Predict reactive species
Full Name cyclin-dependent kinase 5
Calculated Molecular Weight 31 kDa, 33 kDa
Observed Molecular Weight 33 kDa
GenBank Accession NumberBC005115
Gene Symbol CDK5
Gene ID (NCBI) 1020
RRIDAB_2078859
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ00535
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cyclin-dependent kinase 5 (CDK5), belongs to the cyclin-dependent kinase family, is a proline-directed serine/threonine-protein kinase that essential for neuronal cell cycle arrest and differentiation and may be involved in apoptotic cell death in neuronal diseases by triggering abortive cell cycle re-entry. CDK5 predominantly expressed in neurons where it phosphorylates both high molecular weight neurofilaments and microtubule-associated protein tau.

Protocols

Product Specific Protocols
IF protocol for CDK5 antibody 10430-1-APDownload protocol
IHC protocol for CDK5 antibody 10430-1-APDownload protocol
IP protocol for CDK5 antibody 10430-1-APDownload protocol
WB protocol for CDK5 antibody 10430-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Signal Transduct Target Ther

SARS-CoV-2 hijacks cellular kinase CDK2 to promote viral RNA synthesis

Authors - Saisai Guo
mouseWB

Neuropharmacology

Inhibition of Cdk5 rejuvenates inhibitory circuits and restores experience-dependent plasticity in adult visual cortex.

Authors - Yue Li
  • KD Validated
humanWB

Cells

Phosphorylation-Induced Ubiquitination and Degradation of PXR through CDK2-TRIM21 Axis.

Authors - Mengyao Qin
  • KD Validated
humanWB

Am J Transl Res

Hypoxia induces HT-22 neuronal cell death via Orai1/CDK5 pathway-mediated Tau hyperphosphorylation.

Authors - Binbin Fang
mouseWB

J Cell Biochem

Nestin protects mouse podocytes against high glucose-induced apoptosis by a Cdk5-dependent mechanism.

Authors - Liu Wei W
mouse,humanWB

BMC Neurol

The LPA-CDK5-tau pathway mediates neuronal injury in an in vitro model of ischemia-reperfusion insult.

Authors - Yaya Wang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

XinN (Verified Customer) (02-27-2023)

It can recognize endogenous CDK5 with a right MW.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: mouse brain lysate
CDK5 Antibody Western Blot validation (1:2000 dilution) in mouse brain lysate (Cat no:10430-1-AP)
FH

Kathryn (Verified Customer) (04-22-2022)

This CDK5 antibody works very well to stain the nuclei of developed mouse oocytes.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Mouse ovary sections
CDK5 Antibody Immunofluorescence validation (1:100 dilution) in Mouse ovary sections (Cat no:10430-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...