CoraLite® Plus 488-conjugated CDK5 Polyclonal antibody

• 

  IF Staining of SH-SY5Y using CL488-10430

  Immunofluorescent analysis of (4% PFA) fixed SH-SY5Y cells using CoraLite® Plus 488 CDK5 antibody (CL488-10430) at dilution of 1:200.

• Featured Product
• KD/KO Validated

CDK5 Polyclonal Antibody for IF/ICC

Cat No. CL488-10430

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

CDK5, Cell division protein kinase 5, cyclin dependent kinase 5, PSSALRE, TPKII catalytic subunit

---

Tested Applications

• Positive IF/ICC detected in: SH-SY5Y cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-10430 targets CDK5 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0686

  Product name: Recombinant human CDK5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 92-273 aa of BC005115

  Sequence: DSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQ

• Full Name: cyclin-dependent kinase 5
• Calculated Molecular Weight: 31 kDa, 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC005115
• Gene Symbol: CDK5
• Gene ID (NCBI): 1020
• RRID: AB_3672442
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q00535
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Cyclin-dependent kinase 5 (CDK5), belongs to the cyclin-dependent kinase family, is a proline-directed serine/threonine-protein kinase that essential for neuronal cell cycle arrest and differentiation and may be involved in apoptotic cell death in neuronal diseases by triggering abortive cell cycle re-entry. CDK5 predominantly expressed in neurons where it phosphorylates both high molecular weight neurofilaments and microtubule-associated protein tau.