Tested Applications
| Positive WB detected in | Neuro-2a cells, mouse brain tissue, rat brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 1 publications below |
| IHC | See 1 publications below |
Product Information
27058-1-AP targets CDK5R2/p39 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25834 Product name: Recombinant human CDK5R2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 9-75 aa of BC041771 Sequence: PASSAKGRRPGGLPEEKKKAPPAGDEALGGYGAPPVGKGGKGESRLKRPSVLISALTWRRLVAASAK Predict reactive species |
| Full Name | cyclin-dependent kinase 5, regulatory subunit 2 (p39) |
| Observed Molecular Weight | 39 kDa |
| GenBank Accession Number | BC041771 |
| Gene Symbol | CDK5R2/p39 |
| Gene ID (NCBI) | 8941 |
| RRID | AB_2880735 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13319 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CDK5R2 is a neuron-specific activator of CDK5 kinase. It associates with CDK5 to form an active kinase. This protein and neuron-specific CDK5 activator CDK5R1/p39NCK5A both share limited similarity to cyclins, and thus may define a distinct family of cyclin-dependent kinase activating proteins.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CDK5R2/p39 antibody 27058-1-AP | Download protocol |
| WB protocol for CDK5R2/p39 antibody 27058-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





