Tested Applications
| Positive WB detected in | Neuro-2a cells, mouse brain tissue, rat brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27058-1-AP targets CDK5R2/p39 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25834 Product name: Recombinant human CDK5R2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 9-75 aa of BC041771 Sequence: PASSAKGRRPGGLPEEKKKAPPAGDEALGGYGAPPVGKGGKGESRLKRPSVLISALTWRRLVAASAK Predict reactive species |
| Full Name | cyclin-dependent kinase 5, regulatory subunit 2 (p39) |
| Observed Molecular Weight | 39 kDa |
| GenBank Accession Number | BC041771 |
| Gene Symbol | CDK5R2/p39 |
| Gene ID (NCBI) | 8941 |
| RRID | AB_2880735 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13319 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CDK5R2 is a neuron-specific activator of CDK5 kinase. It associates with CDK5 to form an active kinase. This protein and neuron-specific CDK5 activator CDK5R1/p39NCK5A both share limited similarity to cyclins, and thus may define a distinct family of cyclin-dependent kinase activating proteins.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CDK5R2/p39 antibody 27058-1-AP | Download protocol |
| WB protocol for CDK5R2/p39 antibody 27058-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CDK5R2/p39 Polyclonal antibody (Cat# 27058-1-AP) has 1 total citation. It was cited in BMC Cancer (IF 4.1), in a 2024 study on m1A regulator-mediated methylation modification patterns correlated with autophagy for predicting hepatocellular carcinoma prognosis. The antibody was used in WB and IHC applications on human samples. The research field encompasses RNA modification (m1A), autophagy, and liver cancer prognostic biomarkers.
| Species | Application | Title |
|---|---|---|
BMC Cancer m1A regulator-mediated methylation modification patterns correlated with autophagy to predict the prognosis of hepatocellular carcinoma |
