CDK7 Polyclonal antibody

• 

CDK7 Polyclonal Antibody for ELISA

Cat No. 10876-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

ELISA

Synonyms

39 kDa protein kinase, CAK, CAK1, CDK activating kinase, CDK7, CDKN7, Cell division protein kinase 7, cyclin dependent kinase 7, MO15, p39 Mo15, p39MO15, STK1

---

Product Information

10876-2-AP targets CDK7 in ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1108

  Product name: Recombinant human CDK7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-346 aa of BC005298

  Sequence: MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHRHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF

• Full Name: cyclin-dependent kinase 7
• Calculated Molecular Weight: 39 kDa
• GenBank Accession Number: BC005298
• Gene Symbol: CDK7
• Gene ID (NCBI): 1022
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P50613
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.