Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, NIH/3T3 cells, mouse embryo tissue |
| Positive IP detected in | NIH/3T3 cells, HEK-293 cells |
| Positive IHC detected in | human stomach cancer tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | NIH/3T3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
22067-1-AP targets CDK8 in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17148 Product name: Recombinant human CDK8 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 360-464 aa of BC069634 Sequence: TEEEPDDKGDKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY Predict reactive species |
| Full Name | cyclin-dependent kinase 8 |
| Calculated Molecular Weight | 464 aa, 53 kDa |
| Observed Molecular Weight | 53 kDa |
| GenBank Accession Number | BC069634 |
| Gene Symbol | CDK8 |
| Gene ID (NCBI) | 1024 |
| RRID | AB_2878983 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P49336 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CDK8 antibody 22067-1-AP | Download protocol |
| IHC protocol for CDK8 antibody 22067-1-AP | Download protocol |
| IP protocol for CDK8 antibody 22067-1-AP | Download protocol |
| WB protocol for CDK8 antibody 22067-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CDK8 Polyclonal antibody (Cat# 22067-1-AP) has 7 citations published in journals including J Adv Res, Nucleic Acids Res, EMBO J, PLoS Genet, Biochim Biophys Acta Gene Regul Mech, Bull Exp Biol Med, and bioRxiv. Research fields span osteoarthritis and inflammatory microenvironments, cancer biology (BRCA-deficient cells, pancreatic ductal adenocarcinoma, laryngeal squamous cell carcinoma, alveolar rhabdomyosarcoma), DNA damage response and ATR inhibitor resistance, transcriptional regulation via E2F1, and muscle differentiation.
| Species | Application | Title |
|---|---|---|
J Adv Res CDK8 mediated inflammatory microenvironment aggravates osteoarthritis progression
| ||
Nucleic Acids Res Loss of MED12 activates the TGFβ pathway to promote chemoresistance and replication fork stability in BRCA-deficient cells.
| ||
EMBO J CDK8 remodels the tumor microenvironment and promotes resistance to KRAS(G12D) inhibitors and daraxonrasib in PDAC. | ||
PLoS Genet Dual genome-wide CRISPR knockout and CRISPR activation screens identify mechanisms that regulate the resistance to multiple ATR inhibitors.
| ||
Biochim Biophys Acta Gene Regul Mech PP2A and its adapter protein IER5 induce the DNA-binding ability and target gene expression of E2F1 via dephosphorylation at serine 375 | ||
Bull Exp Biol Med Knockdown of Long Noncoding RNA CCAT2 Suppresses Malignant Phenotype in Human Laryngeal Squamous Cell Carcinoma |
Reviews
What customers say
One reviewer used this antibody at a 1:500 dilution on embryo heart tissue for Western Blot and reported detecting a band between 50–65 kD. The reviewer rated the product 3 out of 5 stars. Overall, the feedback suggests the antibody works as expected for WB with a clear band in the anticipated molecular weight range, though the moderate rating indicates room for improvement in performance or consistency.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
SITING (Verified Customer) (04-02-2021) | can see band between 50-65kd
 |
