Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CDK8 Polyclonal antibody

CDK8 Polyclonal Antibody for WB, IHC, FC (Intra), IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, FC (Intra), IP, ELISA

Cell division protein kinase 8, Cyclin dependent kinase 8, Cyclin-dependent kinase 8, EC:2.7.11.22, K35

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for CDK8 in ?

Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, NIH/3T3 cells, mouse embryo tissue
Positive IP detected inNIH/3T3 cells, HEK-293 cells
Positive IHC detected inhuman stomach cancer tissue, human testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inNIH/3T3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22067-1-AP targets CDK8 in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag17148

Product name: Recombinant human CDK8 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 360-464 aa of BC069634

Sequence: TEEEPDDKGDKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY

Predict reactive species
Full Name cyclin-dependent kinase 8
Calculated Molecular Weight 464 aa, 53 kDa
Observed Molecular Weight 53 kDa
GenBank Accession NumberBC069634
Gene Symbol CDK8
Gene ID (NCBI) 1024
RRIDAB_2878983
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP49336
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
FC protocol for CDK8 antibody 22067-1-APDownload protocol
IHC protocol for CDK8 antibody 22067-1-APDownload protocol
IP protocol for CDK8 antibody 22067-1-APDownload protocol
WB protocol for CDK8 antibody 22067-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The CDK8 Polyclonal antibody (Cat# 22067-1-AP) has 7 citations published in journals including J Adv Res, Nucleic Acids Res, EMBO J, PLoS Genet, Biochim Biophys Acta Gene Regul Mech, Bull Exp Biol Med, and bioRxiv. Research fields span osteoarthritis and inflammatory microenvironments, cancer biology (BRCA-deficient cells, pancreatic ductal adenocarcinoma, laryngeal squamous cell carcinoma, alveolar rhabdomyosarcoma), DNA damage response and ATR inhibitor resistance, transcriptional regulation via E2F1, and muscle differentiation.

SpeciesApplicationTitle
mouse,humanWB,IP,IF

J Adv Res

CDK8 mediated inflammatory microenvironment aggravates osteoarthritis progression

Authors - Zhongnan Lin
  • KD Validated
humanWB

Nucleic Acids Res

Loss of MED12 activates the TGFβ pathway to promote chemoresistance and replication fork stability in BRCA-deficient cells.

Authors - Lindsey M Jackson
  • KD Validated

EMBO J

CDK8 remodels the tumor microenvironment and promotes resistance to KRAS(G12D) inhibitors and daraxonrasib in PDAC.

Authors - Kathleen M McAndrews
humanWB

PLoS Genet

Dual genome-wide CRISPR knockout and CRISPR activation screens identify mechanisms that regulate the resistance to multiple ATR inhibitors.

Authors - Emily M Schleicher
  • KD Validated
humanWB

Biochim Biophys Acta Gene Regul Mech

PP2A and its adapter protein IER5 induce the DNA-binding ability and target gene expression of E2F1 via dephosphorylation at serine 375

Authors - Hiroto Takeuchi
mouseWB,IHC

Bull Exp Biol Med

Knockdown of Long Noncoding RNA CCAT2 Suppresses Malignant Phenotype in Human Laryngeal Squamous Cell Carcinoma

Authors - M Li

Reviews

    3.0 out of 5
Add a review

1 verified customer reviews

What customers say

One reviewer used this antibody at a 1:500 dilution on embryo heart tissue for Western Blot and reported detecting a band between 50–65 kD. The reviewer rated the product 3 out of 5 stars. Overall, the feedback suggests the antibody works as expected for WB with a clear band in the anticipated molecular weight range, though the moderate rating indicates room for improvement in performance or consistency.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


SITING (Verified Customer) (04-02-2021)

can see band between 50-65kd

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: EMBRYO HEART
CDK8 Antibody Western Blot validation (1:500 dilution) in EMBRYO HEART (Cat no:22067-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...