CDK9 Polyclonal antibody

• 

  WB analysis of Jurkat using 11705-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 11705-1-AP (CDK9 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 11705-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11705-1-AP (CDK9 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human placenta using 11705-1-AP

  human placenta tissue were subjected to SDS PAGE followed by western blot with 11705-1-AP (CDK9 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human gliomas using 11705-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 11705-1-AP (CDK9 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human gliomas using 11705-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 11705-1-AP (CDK9 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 11705-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 11705-1-AP (CDK9 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 11705-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 11705-1-AP (CDK9 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of U2OS using 11705-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using CDK9 antibody (11705-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

• 

  IF Staining of HeLa using 11705-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CDK9 antibody (11705-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  FC experiment of HeLa using 11705-1-AP

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug CDK9 Polyclonal antibody (11705-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

CDK9 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 11705-1-AP

Publications(15)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Synonyms

C 2k, C-2K, CDC2L4, Cell division cycle 2-like protein kinase 4, CTK1

---

Tested Applications

• Positive WB detected in: HEK-293 cells, human placenta tissue, Jurkat cells, NIH/3T3 cells
• Positive IHC detected in: human gliomas tissue, human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells, U2OS cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 13 publications below
• IHC: See 2 publications below
• IF: See 2 publications below
• IP: See 2 publications below

Product Information

11705-1-AP targets CDK9 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2318

  Product name: Recombinant human CDK9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-372 aa of BC001968

  Sequence: MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF

• Full Name: cyclin-dependent kinase 9
• Calculated Molecular Weight: 372 aa, 43 kDa
• Observed Molecular Weight: 38-42 kDa, 55 kDa
• GenBank Accession Number: BC001968
• Gene Symbol: CDK9
• Gene ID (NCBI): 1025
• RRID: AB_2077302
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P50750
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CDK9(Cyclin-dependent kinase 9) is a member of the Cdc2-like family of kinases. Its cyclin partners are members of the family of cyclin T (T1, T2a and T2b) and cyclin K. The CDK9/cyclin T complexes appear to be involved in regulating several physiological processes. CDK9 has also been described as the kinase of the TAK complex, which is homologous to the P-TEFb complex and involved in HIV replication. In addition, CDK9 seems to have an anti-apoptotic function in monocytes, that may be related to its control over differentiation of monocytes (PMID: 12432243). CDK9 has two isoforms with the molecular mass of 42 kDa and 55 kDa, and the relative abundance of Cdk9(42kDa) and Cdk9(55kDa) changes in different cell types (PMID: 12706900, 15780980).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IP	Cell; Inherited blood cancer predisposition through altered transcription elongation; Authors - Jiawei Zhao
mouse,human	WB,IP	Nat Commun; The methyltransferase METTL3 negatively regulates nonalcoholic steatohepatitis (NASH) progression.; Authors - Xinzhi Li
mouse	WB	Nat Commun; Deficiency of WTAP in hepatocytes induces lipoatrophy and non-alcoholic steatohepatitis (NASH); Authors - Xinzhi Li
human	WB	Nat Commun; Menin enhances c-Myc-mediated transcription to promote cancer progression.; Authors - Gongwei Wu
human	WB	Cell Death Dis; CircFUNDC1 interacts with CDK9 to promote mitophagy in nucleus pulposus cells under oxidative stress and ameliorates intervertebral disc degeneration; Authors - Tianyuan Gu
human	WB	Proteomics; A Simplified Thermal Proteome Profiling Approach to Screen Protein Targets of a Ligand.; Authors - Xiaolei Zhang