Tested Applications
| Positive WB detected in | HeLa cells, HEK-293 cells, Jurkat cells, NIH/3T3 cells, C6 cells |
| Positive IHC detected in | human gliomas tissue, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells, U2OS cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11705-1-AP targets CDK9 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2318 Product name: Recombinant human CDK9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-372 aa of BC001968 Sequence: MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF Predict reactive species |
| Full Name | cyclin-dependent kinase 9 |
| Calculated Molecular Weight | 372 aa, 43 kDa |
| Observed Molecular Weight | 38-42 kDa, 55 kDa |
| GenBank Accession Number | BC001968 |
| Gene Symbol | CDK9 |
| Gene ID (NCBI) | 1025 |
| RRID | AB_2077302 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P50750 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CDK9(Cyclin-dependent kinase 9) is a member of the Cdc2-like family of kinases. Its cyclin partners are members of the family of cyclin T (T1, T2a and T2b) and cyclin K. The CDK9/cyclin T complexes appear to be involved in regulating several physiological processes. CDK9 has also been described as the kinase of the TAK complex, which is homologous to the P-TEFb complex and involved in HIV replication. In addition, CDK9 seems to have an anti-apoptotic function in monocytes, that may be related to its control over differentiation of monocytes (PMID: 12432243). CDK9 has two isoforms with the molecular mass of 42 kDa and 55 kDa, and the relative abundance of Cdk9(42kDa) and Cdk9(55kDa) changes in different cell types (PMID: 12706900, 15780980).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CDK9 antibody 11705-1-AP | Download protocol |
| IF protocol for CDK9 antibody 11705-1-AP | Download protocol |
| IHC protocol for CDK9 antibody 11705-1-AP | Download protocol |
| WB protocol for CDK9 antibody 11705-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-CDK9 antibody (Cat# 11705-1-AP) has 22 citations spanning journals including Cell, Nature Communications, Cancer Research, Molecular Cell, Cell Death & Disease, Phytomedicine, and Autoimmunity Reviews. Research fields cover transcription elongation regulation, cancer (renal cell carcinoma, melanoma, ovarian cancer), NASH, Alzheimer's disease, RNA modification, inflammation, autoimmunity, HIV transcription, and osteoarthritis. Applications include WB, IP, IF, and IHC in human, mouse, and rat samples.
| Species | Application | Title |
|---|---|---|
Cancer Res Tumor-Resident Streptococcus pneumoniae Promotes Malignant Progression and Pazopanib Resistance in Clear Cell Renal Cell Carcinoma | ||
Nat Commun The methyltransferase METTL3 negatively regulates nonalcoholic steatohepatitis (NASH) progression. | ||
Nat Commun Pseudouridylation of 7SK by PUS7 regulates Pol II transcription elongation.
| ||
Nat Commun Integrating cryo-OrbiSIMS with computational modelling and metadynamics simulations enhances RNA structure prediction at atomic resolution | ||
Nat Commun DNA framework-engineered chimeras platform enables selectively targeted protein degradation |
