CoraLite® Plus 488-conjugated CDK9 Polyclonal antibody

CDK9 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-11705

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

Cyclin-dependent kinase 9, CTK1, Cell division cycle 2-like protein kinase 4, CDC2L4, C-2K

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-11705 targets CDK9 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2318

Product name: Recombinant human CDK9 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-372 aa of BC001968

Sequence: MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF

Predict reactive species
Full Name cyclin-dependent kinase 9
Calculated Molecular Weight 372 aa, 43 kDa
Observed Molecular Weight43 kDa, 55 kDa
GenBank Accession NumberBC001968
Gene Symbol CDK9
Gene ID (NCBI) 1025
RRIDAB_2919037
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP50750
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CDK9(Cyclin-dependent kinase 9) is a member of the Cdc2-like family of kinases. Its cyclin partners are members of the family of cyclin T (T1, T2a and T2b) and cyclin K. The CDK9/cyclin T complexes appear to be involved in regulating several physiological processes. CDK9 has also been described as the kinase of the TAK complex, which is homologous to the P-TEFb complex and involved in HIV replication. In addition, CDK9 seems to have an anti-apoptotic function in monocytes, that may be related to its control over differentiation of monocytes (PMID: 12432243). CDK9 has two isoforms with the molecular mass of 42 kDa and 55 kDa, and the relative abundance of Cdk9(42kDa) and Cdk9(55kDa) changes in different cell types (PMID: 12706900, 15780980).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 CDK9 antibody CL488-11705Download protocol
FC protocol for CL Plus 488 CDK9 antibody CL488-11705Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...