CoraLite® Plus 555-conjugated CDKN2A/P16-INK4A Recombinant monoclonal antibody

• 

  IF Staining of HeLa using CL555-81373-8

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite® Plus 555 CDKN2A/P16-INK4A antibody (CL555-81373-8, Clone: 241438C7 ) at dilution of 1:200.

CDKN2A/P16-INK4A Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL555-81373-8

Clone No.241438C7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

CDKN2A, MTS1, CDK4I, CDKN2, CMM2

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL555-81373-8 targets CDKN2A/P16-INK4A in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1328

  Product name: Recombinant human P16-INK4A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 52-156 aa of BC021998

  Sequence: MMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD

• Full Name: cyclin-dependent kinase inhibitor 2A
• Calculated Molecular Weight: 16 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC021998
• Gene Symbol: CDKN2A
• Gene ID (NCBI): 1029
• Conjugate: CoraLite® Plus 555 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 554 nm / 570 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P42771
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

CDKN2A generates several transcript variants which differ in their first exons. At least three alternatively-spliced variants encoding distinct proteins proteins were reported. Two of them named p16-INK4 and p14 are sharing 50% identity. P16 plays an essential role in regulating the cell cycle, and mutations in p16 increase the risk of developing various cancers, including melanoma. Long-term p16(INK4a) expression pushes cells to enter senescence, an irreversible cell-cycle arrest that precludes the growth of would-be cancer cells but also contributes to cellular aging (PMID: 24136988).