CDKN2A/P16-INK4A Recombinant monoclonal antibody

• 

  WB analysis using 81373-8-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 81373-8-RR (P16-INK4A antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 81373-8-RR

  WB result of CDKN2A/P16-INK4A antibody (81373-8-RR; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CDKN2A/P16-INK4A transfected HEK-293 cells.

• 

  IHC staining of human tonsillitis using 81373-8-RR

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 81373-8-RR (P16-INK4A antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human cervical cancer using 81373-8-RR

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 81373-8-RR (P16-INK4A antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 81373-8-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CDKN2A/P16-INK4A antibody (81373-8-RR, Clone: 241438C7 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  Affinity and Kinetic Characterization of 81373-8-RR

  Biolayer interferometry (BLl) kinetic assays of 81373-8-RR against Human P16-INK4A were performed. The affinity constant is 0.336 nM.

• Featured Product
• KD/KO Validated

CDKN2A/P16-INK4A Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 81373-8-RR

Clone No.241438C7

Publications(1)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

p16, p16 INK4, P16 INK4A, p16-INK4, p16INK4A

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, TF-1 cells, SiHa cells
• Positive IHC detected in: human cervical cancer tissue, human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

81373-8-RR targets CDKN2A/P16-INK4A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1328

  Product name: Recombinant human P16-INK4A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 52-156 aa of BC021998

  Sequence: MMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD

• Full Name: cyclin-dependent kinase inhibitor 2A
• Calculated Molecular Weight: 16 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC021998
• Gene Symbol: CDKN2A
• Gene ID (NCBI): 1029
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P42771
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CDKN2A generates several transcript variants which differ in their first exons. At least three alternatively-spliced variants encoding distinct proteins proteins were reported. Two of them named p16-INK4 and p14 are sharing 50% identity. P16 plays an essential role in regulating the cell cycle, and mutations in p16 increase the risk of developing various cancers, including melanoma. Long-term p16(INK4a) expression pushes cells to enter senescence, an irreversible cell-cycle arrest that precludes the growth of would-be cancer cells but also contributes to cellular aging (PMID: 24136988).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Biochem Pharmacol; Metformin reduces senescence induced by obesity-related inflammation in luminal breast cancer through estrogen receptor beta modulation.; Authors - Pere Miquel Morla-Barcelo

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Jordi (Verified Customer) (08-01-2025)

Antibody works very well in WB detection p16 band.

• Applications: Western Blot
• Primary Antibody Dilution: 1:5000
• Cell Tissue Type: Breast cancer cell lines (T47D and MCF7) and Colon cancer cell lines (SW480 and SW620)