• Featured Product
  • KD/KO Validated

CDKN2A/P16-INK4A Recombinant monoclonal antibody

CDKN2A/P16-INK4A Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 81373-8-RR
Clone No.241438C7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

p16, p16 INK4, P16 INK4A, p16-INK4, p16INK4A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 555
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, TF-1 cells, SiHa cells
Positive IHC detected inhuman cervical cancer tissue, human tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

81373-8-RR targets CDKN2A/P16-INK4A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1328

Product name: Recombinant human P16-INK4A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 52-156 aa of BC021998

Sequence: MMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD

Predict reactive species
Full Name cyclin-dependent kinase inhibitor 2A
Calculated Molecular Weight 16 kDa
Observed Molecular Weight 16 kDa
GenBank Accession NumberBC021998
Gene Symbol CDKN2A
Gene ID (NCBI) 1029
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP42771
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CDKN2A generates several transcript variants which differ in their first exons. At least three alternatively-spliced variants encoding distinct proteins proteins were reported. Two of them named p16-INK4 and p14 are sharing 50% identity. P16 plays an essential role in regulating the cell cycle, and mutations in p16 increase the risk of developing various cancers, including melanoma. Long-term p16(INK4a) expression pushes cells to enter senescence, an irreversible cell-cycle arrest that precludes the growth of would-be cancer cells but also contributes to cellular aging (PMID: 24136988).

Protocols

Product Specific Protocols
IF protocol for CDKN2A/P16-INK4A antibody 81373-8-RRDownload protocol
IHC protocol for CDKN2A/P16-INK4A antibody 81373-8-RRDownload protocol
WB protocol for CDKN2A/P16-INK4A antibody 81373-8-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Jordi (Verified Customer) (08-01-2025)

Antibody works very well in WB detection p16 band.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: Breast cancer cell lines (T47D and MCF7) and Colon cancer cell lines (SW480 and SW620)
Loading...
||
New chat Able
正在加载,请稍候...