CDNF Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CDNF Polyclonal antibody (32802-1-AP)

• 

  WB analysis using 32802-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32802-1-AP (CDNF antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

CDNF Polyclonal Antibody for WB, ELISA

Cat No. 32802-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, ELISA

Synonyms

Armetl1, ARMET-like protein 1, Cerebral dopamine neurotrophic factor, Conserved dopamine neurotrophic factor

---

Tested Applications

• Positive WB detected in: mouse heart tissue, mouse skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32802-1-AP targets CDNF in WB, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg2845

  Product name: Recombinant Mouse ARMETL1 protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 27-187 aa of NM_177647.4

  Sequence: LEAGVGPRADCEVCKEFLDRFYNSLLSRGIDFSADTIEKELLNFCSDAKGKENRLCYYLGATTDAATKILGEVTRPMSVHIPAVKICEKLKKMDSQICELKYGKKLDLASVDLWKMRVAELKQILQRWGEECRACAEKSDYVNLIRELAPKYVEIYPQTEL

• Full Name: arginine-rich, mutated in early stage tumors-like 1
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 18-21 kDa
• GenBank Accession Number: NM_177647.4
• Gene Symbol: Armetl1
• Gene ID (NCBI): 227526
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8CC36
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cerebral dopamine neurotrophic factor (CDNF) is a secreted protein belonging to the mesencephalic astrocyte-derived neurotrophic factor (MANF) family. Unlike classical neurotrophic factors, CDNF is primarily localized in the endoplasmic reticulum and exerts neuroprotective effects through modulating the unfolded protein response (UPR). CDNF has demonstrated potent protective effects on dopaminergic neurons in preclinical models of Parkinson's disease (PD), reducing neuroinflammation and alpha-synuclein aggregation. Its unique mechanism-targeting ER stress rather than receptor tyrosine kinases-offers a promising therapeutic avenue for neurodegenerative disorders. Clinical trials are currently evaluating recombinant human CDNF as a disease-modifying therapy for PD (PMID: 34284712; 37555005; 38290651).