Tested Applications
| Positive WB detected in | mouse brain tissue, human heart tissue |
| Positive IP detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 2 publications below |
| IF | See 1 publications below |
Product Information
13175-1-AP targets CDS2 in WB, IF, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3842 Product name: Recombinant human CDS2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 354-445 aa of BC025751 Sequence: GFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPSKLIQQFLTLRPDQQLHIFNTLRSHLIDKGMLTSTTEDE Predict reactive species |
| Full Name | CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 |
| Calculated Molecular Weight | 445 aa, 51 kDa |
| Observed Molecular Weight | 51 kDa |
| GenBank Accession Number | BC025751 |
| Gene Symbol | CDS2 |
| Gene ID (NCBI) | 8760 |
| RRID | AB_2291458 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95674 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun AGPAT2 interaction with CDP-diacylglycerol synthases promotes the flux of fatty acids through the CDP-diacylglycerol pathway.
| ||
Nat Commun Anti-angiogenic effects of VEGF stimulation on endothelium deficient in phosphoinositide recycling. | ||
Sci Rep Enzymatic fluorometric assays for quantifying all major phospholipid classes in cells and intracellular organelles. | ||
Nat Genet The synthetic lethal interaction between CDS1 and CDS2 is a vulnerability in uveal melanoma and across multiple tumor types |





