Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
28407-1-AP targets CDS2 in WB, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29228 Product name: Recombinant human CDS2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-65 aa of BC025751 Sequence: MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSR Predict reactive species |
| Full Name | CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 |
| Calculated Molecular Weight | 445 aa, 51 kDa |
| Observed Molecular Weight | 50-51 kDa |
| GenBank Accession Number | BC025751 |
| Gene Symbol | CDS2 |
| Gene ID (NCBI) | 8760 |
| RRID | AB_2918159 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95674 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for CDS2 antibody 28407-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

