Tested Applications
Positive WB detected in | mouse skin tissue |
Positive IHC detected in | human brown disease Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:3000 |
Immunohistochemistry (IHC) | IHC : 1:150-1:600 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
IF | See 1 publications below |
Product Information
27953-1-AP targets CDSN in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag27688 Product name: Recombinant human CDSN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC031993 Sequence: MGSSRAPWMGRVGGHGMMALLLAGLLLPGTLAKSIGTFSDPCKDPTRITSPNDPCLTGKGDSSGFSSYSG Predict reactive species |
Full Name | corneodesmosin |
Calculated Molecular Weight | 528 aa, 52 kDa |
Observed Molecular Weight | 55-65 kDa |
GenBank Accession Number | BC031993 |
Gene Symbol | CDSN |
Gene ID (NCBI) | 1041 |
RRID | AB_2881022 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q15517 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CDSN antibody 27953-1-AP | Download protocol |
IHC protocol for CDSN antibody 27953-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |