CDSN Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CDSN Polyclonal antibody (27953-1-AP)

CDSN Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27953-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, ELISA

Synonyms

S protein, HTSS, D6S586E, corneodesmosin

• 

  WB analysis of mouse skin using 27953-1-AP

  mouse skin tissue were subjected to SDS PAGE followed by western blot with 27953-1-AP (CDSN antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brown disease using 27953-1-AP

  Immunohistochemical analysis of paraffin-embedded human brown disease slide using 27953-1-AP (CDSN antibody) at dilution of 1:300 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CDSN in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse skin tissue
• Positive IHC detected in: human brown disease; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:150-1:600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27953-1-AP targets CDSN in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27688

  Product name: Recombinant human CDSN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-70 aa of BC031993

  Sequence: MGSSRAPWMGRVGGHGMMALLLAGLLLPGTLAKSIGTFSDPCKDPTRITSPNDPCLTGKGDSSGFSSYSG

• Full Name: corneodesmosin
• Calculated Molecular Weight: 528 aa, 52 kDa
• Observed Molecular Weight: 55-65 kDa
• GenBank Accession Number: BC031993
• Gene Symbol: CDSN
• Gene ID (NCBI): 1041
• RRID: AB_2881022
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15517
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The CDSN Polyclonal antibody (Cat# 27953-1-AP) has 1 citation. It was used in a study published in JID Innov (2021), which investigated how loricrin and NRF2 coordinate cornification in mouse skin. The research field is dermatology/skin biology, specifically focusing on epidermal differentiation and the skin barrier. The antibody was applied via immunofluorescence (IF) in this study.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	JID Innov; Loricrin and NRF2 Coordinate Cornification.; Authors - Yosuke Ishitsuka