Tested Applications
| Positive WB detected in | mouse skin tissue |
| Positive IHC detected in | human brown disease Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:150-1:600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IF | See 1 publications below |
Product Information
27953-1-AP targets CDSN in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27688 Product name: Recombinant human CDSN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC031993 Sequence: MGSSRAPWMGRVGGHGMMALLLAGLLLPGTLAKSIGTFSDPCKDPTRITSPNDPCLTGKGDSSGFSSYSG Predict reactive species |
| Full Name | corneodesmosin |
| Calculated Molecular Weight | 528 aa, 52 kDa |
| Observed Molecular Weight | 55-65 kDa |
| GenBank Accession Number | BC031993 |
| Gene Symbol | CDSN |
| Gene ID (NCBI) | 1041 |
| RRID | AB_2881022 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15517 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CDSN antibody 27953-1-AP | Download protocol |
| WB protocol for CDSN antibody 27953-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



