Tested Applications
Positive WB detected in | Caco-2 cells, mouse small intestine tissue, mouse stomach tissue, mouse colon tissue, rat colon tissue |
Positive IP detected in | Caco-2 cells |
Positive IHC detected in | human colon cancer tissue, mouse colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | Caco-2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
21655-1-AP targets CDX1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag16376 Product name: Recombinant human CDX1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 105-154 aa of BC096252 Sequence: KQQQQQPPQPPMAHDITATPAGPSLGGLCPSNTSLLATSSPMPVKEEFLP Predict reactive species |
Full Name | caudal type homeobox 1 |
Calculated Molecular Weight | 265 aa, 28 kDa |
Observed Molecular Weight | 28-35 kDa |
GenBank Accession Number | BC096252 |
Gene Symbol | CDX1 |
Gene ID (NCBI) | 1044 |
RRID | AB_2878901 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P47902 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CDX1 antibody 21655-1-AP | Download protocol |
IHC protocol for CDX1 antibody 21655-1-AP | Download protocol |
IF protocol for CDX1 antibody 21655-1-AP | Download protocol |
IP protocol for CDX1 antibody 21655-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |