Tested Applications
| Positive WB detected in | HeLa cells, L02 cells, HepG2 cells |
| Positive IHC detected in | human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
This antibody is not recommended for IF application.
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:150-1:600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 5 publications below |
| IHC | See 2 publications below |
Product Information
66649-1-Ig targets CEBPB in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20073 Product name: Recombinant human CEBPB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-266 aa of BC007538 Sequence: MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPAGELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDLFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPADAKAPPTACYAGAAPAPSQVKSKAKKT Predict reactive species |
| Full Name | CCAAT/enhancer binding protein (C/EBP), beta |
| Calculated Molecular Weight | 345 aa, 36 kDa |
| Observed Molecular Weight | 40-45 kDa |
| GenBank Accession Number | BC007538 |
| Gene Symbol | CEBPB |
| Gene ID (NCBI) | 1051 |
| RRID | AB_2882006 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P17676 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CCAAT/enhancer-binding protein beta (CEBPB), also known as LAP, is a important transcriptional activator in the regulation of genes involved in immune and inflammatory responses. It specifically binds to an IL-1 response element in the IL-6 gene. NF-IL6 also binds to regulatory regions of several acute-phase and cytokines genes. It probably plays a role in the regulation of acute-phase reaction, inflammation and hemopoiesis. The consensus recognition site is 5'-T[TG]NNGNAA[TG]-3'. Functions in brown adipose tissue (BAT) differentiation By similarity. Regulates the transcriptional induction of peroxisome proliferator-activated receptor gamma (PPARG). CEBPb mRNAs possess alternative translation-initiation codons, which result in the formation of truncated forms of the protein. All major isoforms of CEBPB (38, 34, and 20 kDa) are expressed, with the 34 and 20kDa isoforms being more abundant in preovulatory follicles and further increased in corpora lutea (CL)(PMID:15647458).The truncated protein of 18 kDa (relative to the 30 kDa full-length protein that is known as LAP, or p30 CEBPb or liver-activating protein) lacks a transactivation domain,also known as LIP (p19 CEBPb or liver-inhibitory protein), can form homodimers or heterodimerize with other family members and, as it lacks the transactivation domain, can attenuate the transcriptional activation properties of the other isoforms.(10051447). Three variants of CEBPBs have been detected in many cell types: a 46 kDa full-length liver-enriched transcription-activating protein (LAP1), a 42 kDa LAP2 and a 20-kDa liver-enriched transcription-inhibitory protein (LIP). These variants are the result of an alternative translation initiation due to a leaky ribosomal scanning mechanism.(PMID:18820298).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CEBPB antibody 66649-1-Ig | Download protocol |
| WB protocol for CEBPB antibody 66649-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Int J Biol Macromol CircDYM attenuates microglial apoptosis via CEBPB/ZC3H4 axis in LPS-induced mouse model of depression | ||
Int J Mol Sci Piperine Improves Lipid Dysregulation by Modulating Circadian Genes Bmal1 and Clock in HepG2 Cells. | ||
Stem Cell Res Ther The effects of BMMSC treatment on lung tissue degeneration in elderly macaques. | ||
Mol Hum Reprod Identification of transcription factors that regulate placental sFLT1 expression | ||
Br J Cancer Impact of gut microbiome on radiotherapy and immunotherapy efficacy in microsatellite-stable colorectal cancer: role of propionic acid and B. fragilis | ||
J Ethnopharmacol Hydrangea paniculata coumarins alleviate adriamycin-induced renal lipotoxicity through activating AMPK and inhibiting C/EBPβ |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Boyan (Verified Customer) (01-25-2019) | Good. It only works for human CEBPb protein, because the antigen of this antibody is targeting the N-terminus of the protein, which is not conserved in human and mouse.
|







