Tested Applications
| Positive IHC detected in | mouse liver tissue, mouse colon tissue,  rat liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
| Positive IF/ICC detected in | MCF-7 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:1000-1:4000 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below | 
| WB | See 4 publications below | 
| IHC | See 4 publications below | 
| IF | See 1 publications below | 
Product Information
12997-1-AP targets CEBPG in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, mouse | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag3663 Product name: Recombinant human CEBPG protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-150 aa of BC013128 Sequence: MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDNAGQ Predict reactive species | 
                                    
| Full Name | CCAAT/enhancer binding protein (C/EBP), gamma | 
| Calculated Molecular Weight | 150 aa, 16 kDa | 
| Observed Molecular Weight | 16-18 kDa | 
| GenBank Accession Number | BC013128 | 
| Gene Symbol | CEBPG | 
| Gene ID (NCBI) | 1054 | 
| RRID | AB_2877902 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | P53567 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CEBPG antibody 12997-1-AP | Download protocol | 
| IHC protocol for CEBPG antibody 12997-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Neuron Core transcription programs controlling injury-induced neurodegeneration of retinal ganglion cells.
  | ||
Int J Biol Sci Novel LncRNA LINC02936 Suppresses Ferroptosis and Promotes Tumor Progression by Interacting with SIX1/CP Axis in Endometrial Cancer | ||
Am J Cancer Res CEBPG promotes esophageal squamous cell carcinoma progression by enhancing PI3K-AKT signaling.
  | ||
Cancer Inform Comprehensive Analysis of CCAAT/Enhancer Binding Protein Family in Ovarian Cancer | ||
Cell Biosci Single-cell multi-omics analysis reveals candidate therapeutic drugs and key transcription factor specifically for the mesenchymal subtype of glioblastoma | ||
Autophagy RETREG1-mediated reticulophagy is activated by an ATF4-CEBPG/C/EBPγ heterodimer and confers protection against lipotoxicity | 













