CENPC Polyclonal antibody, PBS Only

• 

  WB analysis of HeLa using 14250-1-AP (same clone as 14250-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 14250-1-AP (CENPC antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14250-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 14250-1-AP (same clone as 14250-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 14250-1-AP (CENPC antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14250-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A431 using 14250-1-AP (same clone as 14250-1-PBS)

  A431 cells were subjected to SDS PAGE followed by western blot with 14250-1-AP (CENPC antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14250-1-PBS in a different storage buffer formulation.

CENPC Polyclonal Antibody for WB, Indirect ELISA

Cat No. 14250-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

14250-1-PBS targets CENPC in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5523

  Product name: Recombinant human CENPC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 598-943 aa of BC041117

  Sequence: EGSGGIVGHDEISRCSLSEPLESDEADLAKKKNLDCSRSTRSSKNEDNIMTAQNVPLKPQTSGYTCNIPTESNLDSGEHKTSVLEESGPSRLNNNYLMSGKNDVDDEEVHGSSDDSKQSKVIPKNRIHHKLVLPSNTPNVRRTKRTRLKPLEYWRGERIDYQGRPSGGFVISGVLSPDTISSKRKAKENIGKVNKKSNKKRICLDNDERKTNLMVNLGIPLGDPLQPTRVKDPETREIILMDLVRPQDTYQFFVKHGELKVYKTLDTPFFSTGKLILGPQEEKGKQHVGQDILVFYVNFGDLLCTLHETPYILSTGDSFYVPSGNYYNIKNLRNEESVLLFTQIKR

• Full Name: centromere protein C 1
• Calculated Molecular Weight: 107 kDa
• Observed Molecular Weight: 140 kDa
• GenBank Accession Number: BC041117
• Gene Symbol: CENPC
• Gene ID (NCBI): 1060
• RRID: AB_10642008
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q03188
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.