CEP19 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse kidney using 26036-1-AP (same clone as 26036-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 26036-1-AP (CEP19 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26036-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 26036-1-AP (same clone as 26036-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 26036-1-AP (C3orf34 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26036-1-PBS in a different storage buffer formulation.

CEP19 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 26036-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

C3orf34, Centrosomal protein of 19 kDa, HSD5, UPF0709 protein C3orf34

---

Product Information

26036-1-PBS targets CEP19 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22035

  Product name: Recombinant human C3orf34 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-163 aa of BC007827

  Sequence: MMCTAKKCGIRFQPPAIILIYESEIKGKIRQRIMPVRNFSKFSDCTRAAEQLKNNPRHKSYLEQVSLRQLEKLFSFLRGYLSGQSLAETMEQIQRETTIDPEEDLNKLDDKELAKRKSIMDELFEKNQKKKDDPNFVYDIEVEFPQDDQLQSCGWDTESADEF

• Full Name: chromosome 3 open reading frame 34
• Calculated Molecular Weight: 163 aa, 19 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC007827
• Gene Symbol: CEP19
• Gene ID (NCBI): 84984
• RRID: AB_2651171
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96LK0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.