CEP19 Polyclonal antibody

• 

  WB analysis of mouse kidney using 26036-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 26036-1-AP (CEP19 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 26036-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 26036-1-AP (C3orf34 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

CEP19 Polyclonal Antibody for WB, ELISA

Cat No. 26036-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, IP, ELISA

Synonyms

C3orf34, Centrosomal protein of 19 kDa, HSD5, UPF0709 protein C3orf34

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, mouse liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IF: See 5 publications below
• IP: See 1 publications below

Product Information

26036-1-AP targets CEP19 in WB, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22035

  Product name: Recombinant human C3orf34 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-163 aa of BC007827

  Sequence: MMCTAKKCGIRFQPPAIILIYESEIKGKIRQRIMPVRNFSKFSDCTRAAEQLKNNPRHKSYLEQVSLRQLEKLFSFLRGYLSGQSLAETMEQIQRETTIDPEEDLNKLDDKELAKRKSIMDELFEKNQKKKDDPNFVYDIEVEFPQDDQLQSCGWDTESADEF

• Full Name: chromosome 3 open reading frame 34
• Calculated Molecular Weight: 163 aa, 19 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC007827
• Gene Symbol: CEP19
• Gene ID (NCBI): 84984
• RRID: AB_2651171
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96LK0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Nat Commun; Microtubule asters anchored by FSD1 control axoneme assembly and ciliogenesis.; Authors - Hai-Qing Tu
mouse	WB,IP,IF	Nat Commun; The molecular dynamics of subdistal appendages in multi-ciliated cells.; Authors - Hyunchul Ryu
human	IF	Dev Cell; Comparative Super-Resolution Mapping of Basal Feet Reveals a Modular but Distinct Architecture in Primary and Motile Cilia.; Authors - Quynh P H Nguyen
human	IF	Dev Cell; The CEP19-RABL2 GTPase Complex Binds IFT-B to Initiate Intraflagellar Transport at the Ciliary Base.; Authors - Tomoharu Kanie
	IF	Sci Rep; The apical ciliary adhesion complex is established at the basal foot of motile cilia and depends on the microtubule network; Authors - Maria Chatzifrangkeskou