CERK Polyclonal antibody

CERK Polyclonal Antibody for WB, IHC, ELISA
Cat No. 25731-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Acylsphingosine kinase, ceramide kinase, CERK, dA59H18.2, dA59H18.3, hCERK, KIAA1646, Lipid kinase 4, LK4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse heart tissue, mouse liver tissue
Positive IHC detected inmouse heart tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 2 publications below

Product Information

25731-1-AP targets CERK in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag22774

Product name: Recombinant human CERK protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 224-537 aa of BC126940

Sequence: AVLVPSSLRIGIIPAGSTDCVCYSTVGTSDAETSALHIVVGDSLAMDVSSVHHNSTLLRYSVSLLGYGFYGDIIKDSEKKRWLGLARYDFSGLKTFLSHHCYEGTVSFLPAQHTVGSPRDRKPCRAGCFVCRQSKQQLEEEQKKALYGLEAAEDVEEWQVVCGKFLAINATNMSCACRRSPRGLSPAAHLGDGSSDLILIRKCSRFNFLRFLIRHTNQQDQFDFTFVEVYRVKKFQFTSKHMEDEDSDLKEGGKKRFGHICSSHPSCCCTVSNSSWNCDGEVLHSPAIEVRVHCQLVRLFARGIEENPKPDSHS

Predict reactive species
Full Name ceramide kinase
Calculated Molecular Weight 537 aa, 60 kDa, 38 kDa
Observed Molecular Weight 38 kDa
GenBank Accession NumberBC126940
Gene Symbol CERK
Gene ID (NCBI) 64781
RRIDAB_2880214
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8TCT0
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ceramide kinase (CERK) is a crucial lipid kinase that specifically catalyses ceramide (CER) to ceramide-1-phosphate. It plays a vital role in biological functions and certain diseases, including aberrant wound healing (PMID: 24823941), obesity-diabetes (PMID: 22465662), mesangio-proliferativekidney diseases (PMID: 25134723), cancer (PMID: 25164007) and neuroblastoma (PMID: 22579669). CERK has 2 isoforms with the molecular weight of 60 and 38 kDa.

Protocols

Product Specific Protocols
IHC protocol for CERK antibody 25731-1-APDownload protocol
WB protocol for CERK antibody 25731-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Burns

Identification of the potential role of PANoptosis-related genes in burns via bioinformatic analyses and experimental validation

Authors - Jiacong Chen
humanWB

Ecotoxicol Environ Saf

The PPARβ/CERK/C1P signaling pathway is a potential mechanism by which antimony exposure promotes prostate cancer cell proliferation

Authors - Jianxi Shi
Loading...
||
New chat Able
正在加载,请稍候...